KEGG   Tarenaya hassleriana (spider flower): 104810121Help
Entry
104810121         CDS       T04125                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00010  Glycolysis / Gluconeogenesis
thj00562  Inositol phosphate metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104810121
   00562 Inositol phosphate metabolism
    104810121
Enzymes [BR:thj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104810121
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104810121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 HnRNPA1
Motif
Other DBs
NCBI-GeneID: 104810121
NCBI-ProteinID: XP_010534618
Position
Unknown
AA seq 484 aa AA seqDB search
MKIVWILLLSMLVASNADQGFDVRQHLSTVTRYDAVKDVAQNLFEPSEVPRDCTPIHLNL
VARHGTRSPTKKRLRELENLAVRFKELVKDAEGRNSPLHKIPGWLREWESPWKGKVKGGE
LISLGEEELYRLGIQVRERFPNLFEDDYHPDVYMIRATQIPRASASAVAFGMGLFSGRGK
LGPGQNRAFAVTSENRASDTKLRFFECCQNYKSYRKSKEPAVDKLKEPVLYEITAAVAKR
YDINFTKQDISSLWFLCKQEASLLNVTDQACALFTPSEVALLEWTDDLEVFILKGYGNSL
NYRMGAPLLQDVLHSMEEAVKARKEKLPSGSYEKARLRFAHAETVVPFSCLLGLFLDGSD
FEKIKKEQPLELPTKPPKSRNFRGRTMAPFGGNNMLVLYSCPADSSSANYFVQVLHNEQP
IPLPGCDGKDFCPLEVFKERIVEPHLKHDFDILCNAKPDGQPASSTLSLLYGWLFGSRNG
DTEL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgtttggattttgttgttgtcaatgttagtggcttcaaacgcggatcaaggt
ttcgatgttcgtcaacacctatccaccgttaccagatacgatgctgtgaaagatgttgct
caaaatctgtttgagccttcagaagttccccgtgactgcacacctatccatcttaacctt
gtggctaggcatggaactcggtctccgaccaagaaacggttgcgagaattagagaatttg
gctgttcggtttaaggaacttgtaaaagatgcagaaggtaggaattcgccgttgcacaag
attcctggctggttaagggagtgggaatctccttggaaaggaaaagtgaagggtggggaa
ctgataagtctaggagaagaggaattgtatcggctgggaattcaggtcagagagagattt
cccaacctgtttgaggatgattaccacccggatgtctacatgataagggctacacagatt
cctcgagcatctgcaagtgctgtggcgtttggcatggggctgtttagtgggagaggaaag
ctgggacctggccagaatagagcattcgctgtcaccagtgaaaaccgtgcaagtgataca
aagttgagatttttcgagtgttgtcaaaactataagtcctacagaaaatccaaggaacct
gctgttgataaactcaaggaacctgttctgtacgagattactgcagctgtagcgaagaga
tatgatataaatttcacaaaacaggatatttcttcactctggtttctgtgcaagcaggaa
gcatcactgctaaatgtaactgatcaagcttgtgccctttttaccccatctgaggttgct
ttgcttgagtggacggatgatctagaggtgttcatcctcaaaggttatggcaattccttg
aactatcgaatgggagctcctttgctacaggatgttttacattcaatggaagaagctgtc
aaggcccgaaaagagaagctgccttctggaagttatgagaaggcaaggcttaggtttgca
catgctgaaactgtggttcccttttcttgtctccttgggcttttcctcgatggatctgac
ttcgagaaaattaaaaaggagcaacctttggaactccctacgaagccacccaagagcaga
aacttcagaggccgtacaatggctccttttggtgggaacaacatgctcgtcctctatagc
tgtcctgcagactcctcctcagccaattactttgtgcaagttctgcataatgagcaaccc
attccacttccaggttgcgatgggaaggacttctgccctcttgaagttttcaaggagaga
atagtggagcctcatctcaagcatgactttgacattctctgcaatgctaagccggatggg
cagccagcatccagtacgttgtctttgctgtacggttggctgtttggatcgagaaatgga
gataccgagctctag

DBGET integrated database retrieval system