KEGG   Tarenaya hassleriana (spider flower): 104810342Help
Entry
104810342         CDS       T04125                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00052  Galactose metabolism
thj00500  Starch and sucrose metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104810342
   00500 Starch and sucrose metabolism
    104810342
Enzymes [BR:thj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104810342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104810342
NCBI-ProteinID: XP_010534898
Position
Unknown
AA seq 584 aa AA seqDB search
MAKDIGLVVLLSLLLLGNYVVNLEASHHHHHVYKRFQSSKAKSPPPNQPYRTGYHFQPPK
NWMNDPNGPMLYKGIYHLFYQYNPNGAVWGNIVWGHSTSTDLVNWVPHPPAISPSEPYDA
GGCWSGSVTILLDGKPVILYTGVHGTDNIQTQNLAEPTNLSDPFLRQWSKSPANPLMAPT
AANSINATSFRDPTTAWLSLDGKWRVIIGSKIDRRGLAILYTSKDFVNWTESPEPLHSDD
GTGMWECPDFYPVARFGSLGVETSSFGGPPLIKHVLKMSLDDTKHDYYTIGTYDRVKDVY
VPDKGFAQNGSAPRYDYGKYYASKTFYDPLKNRRVLWGWVNESSPVVNDVEKGWSGLQAI
PRKIWLDRSGKQLIQWPIKEIEKLRATQVKWPYKVLEAESVLEVSGITASQADVEVSFKV
RGLEKADEIEPDWTDAQLICSEQNESVKAGLGPFGLMVLASKSLEEYTSVYFRIFKAHND
SNKYVVVMCSDQSRSSLEQEDNDRTTYGAFVDIDPFLQPLSLRTLIDHSIVESFGGRGEA
CITARIYPKLAIGEEAHLYVFNNGRQSVHLSSLSAWTMATAHIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagacattggcttagtggtgctcttgtcattgttattacttggtaactatgtt
gtcaatcttgaagcctcacatcatcatcatcatgtttacaagagatttcagagctcgaaa
gccaaatctcctccgccaaaccagccctaccggaccggttatcatttccaacctccaaaa
aattggatgaacgatcctaatggaccaatgttatacaaaggaatatatcacctcttctac
caatataacccaaacggcgccgtttgggggaacatcgtgtggggccactccacgtcgacg
gacctcgtcaactgggttccacaccctccggcgatctctccttcggagccgtacgacgcc
ggaggctgctggtccggctccgtcacgatcctcctcgatggcaaacccgtaattttatac
accggagtccacggcaccgacaacatccaaacccagaacctggccgagcccacgaacctc
tccgatccatttctccggcagtggtccaagtcgccagcgaatcccctcatggctccgacc
gccgccaacagcatcaacgccacctccttccgtgaccccaccactgcatggctcagccta
gacggaaagtggcgcgtaatcattggtagcaagatcgaccgccgtggactagcgattctc
tacacgagcaaagacttcgtcaactggaccgagtcgccggagccgttgcactccgacgac
ggaaccggaatgtgggaatgtccggacttttacccggtggccaggttcggttcgttgggc
gtcgaaacgtcgtcgtttggtggtcctccgttaattaagcacgtgctgaaaatgagcttg
gacgacacgaagcacgattattacacgatcgggacgtacgatcgtgtcaaggacgtgtac
gttccggacaaagggttcgcacagaacggttcggctccgaggtacgattacggcaaatat
tacgcgtcgaagactttttacgatcctttgaagaatcggagggtcttgtggggttgggtc
aacgagtcgtctcctgtggtcaacgatgtggagaagggctggtccggtctccaggcgatt
ccgaggaaaatatggctcgatagatcgggaaagcagttgattcaatggccgattaaggag
attgagaaattacgtgcgacacaagtcaaatggccgtacaaagttcttgaggctgaatct
gtccttgaagtttctggcatcacagcctcacaggccgacgtagaggtttcgttcaaagtg
agaggcctggagaaggcagatgaaatagaaccggattggaccgacgcgcaattgatatgc
agtgaacaaaatgaatcggttaaggccggtttagggccattcggtttaatggttctcgca
tcaaagagcttggaagagtacacatctgtctatttcaggatcttcaaggcccacaatgat
agtaacaagtatgtcgtcgtcatgtgcagtgaccaatccagatcttccttggagcaagaa
gataacgacagaacaacttatggtgcttttgttgatatcgacccttttctccaaccactc
tctctcaggacattgattgaccattcgatagtggagagctttggagggagaggggaggca
tgcatcacagcaagaatctacccgaaactggcgattggagaagaagctcatctctatgtc
ttcaacaatggccgccaaagcgttcatctttcaagcctgagtgcttggaccatggccact
gcccatatcaactga

DBGET integrated database retrieval system