KEGG   Tarenaya hassleriana (spider flower): 104811240Help
Entry
104811240         CDS       T04125                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00052  Galactose metabolism
thj00500  Starch and sucrose metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104811240
   00500 Starch and sucrose metabolism
    104811240
Enzymes [BR:thj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104811240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104811240
NCBI-ProteinID: XP_010536191
Position
Unknown
AA seq 589 aa AA seqDB search
MGRSWGSLFWLITSITISCIASSLQDSCREENRRSLNLFRADRSPDSDQPYRTRFHFQPP
ENWLNDPNGPMYYKGVYHLFYQYNPSGPLFGDVMIWAHSVSYDLINWIQLEHALYPSDSF
DINSCWSGSATILPGGKPVIMYTGIDSGNHQVTNIAEPKNISDPLLREWVKFEGNPVMVP
PVNVRVDGFRDPTTAWQGQDGRWRVIVGAEAVNSTKGMALLYRSDDFIRWTKFPDPLFES
EVTGMWECPDFYPVSVNGTNGVDTSVNNAHVKHVLKAGYGEHDFYVIGTYFPETEKFVTD
SDFTNTVSDLRYDHGKFYASKTFFDSAKNRRILWGWVNESDSKEDDLHKGWSGLQSVPRK
IWLDQTGKRLVQWPVDELVNLRGNRVAVHGEKLEGGSVLEIPGITASQADVEVVFELPDL
GDAAEYLEENQVDPQELCDRYRASSKGIFGPFGVLALASDDLSERTAIFFRVFRRADGYS
TLMCSDHSRSSLRHHLDKATFGTFLDIDPRYENISLRCLIDRSVIESYGGGGRSVITSRV
YPKLAIGEEAHLYVFNNGTKSVVPSSLEAWSVQNAQINSIEFVAEFLNM
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgatcttggggttctctcttttggttaatcacatctataacaatctcttgcatc
gcatcatcactgcaagattcctgtcgcgaggaaaatcggagatccctgaatctttttcgg
gcggaccgatcgccagattccgaccagccttaccgaactcgtttccacttccagcctcca
gaaaattggcttaatgaccccaatgggccgatgtactacaaaggggtttaccatctgttt
taccagtacaatccctccggtcccttgttcggcgacgttatgatatgggcacactcggtt
tcgtacgatctgatcaactggatccagctcgagcacgccctttatccctcggattcgttt
gacatcaacagctgctggtcgggatctgccacgatcctcccgggaggcaaaccggtaatt
atgtataccggtattgactccggaaaccatcaggtcacgaatatcgcagaaccaaagaac
atttccgatcctttgctcagggaatgggtgaagtttgagggcaatccggttatggttcct
cctgttaacgtcagggttgatgggtttcgtgaccctacaacagcatggcagggtcaagac
gggagatggagagtcatcgttggagccgaggccgtcaatagtaccaaagggatggcattg
ttgtatcgtagcgacgattttatccgctggacgaagtttccggaccctcttttcgagtct
gaggttaccggaatgtgggaatgtcctgatttctatccggtttccgtcaacgggacaaac
ggagtcgacacttcagtgaacaacgcgcacgtcaagcatgtgttgaaggcgggatacgga
gaacacgacttctacgtcatcggtacatatttcccggagactgagaagtttgttacggat
tccgatttcacgaatacggtctcagatctgagatacgatcacgggaaattttacgcgtca
aagacgtttttcgacagtgctaagaaccggaggatcctgtggggttgggtgaatgagtcg
gacagtaaagaagatgatcttcacaaaggatggtccggtcttcagtccgtgccgagaaag
atttggctggatcaaaccgggaagagacttgtgcagtggccagtcgatgaactcgtgaat
ctccggggaaaccgagtcgccgtccatggtgagaaactcgagggcggctcggtccttgaa
attcccggcatcactgcttcacaagccgacgtggaagtagttttcgagctacccgatctc
ggagatgctgcagaatacctagaagaaaaccaagtggatccccaagaactatgcgaccgt
tacagggcctcgagcaaaggcattttcgggccgttcggagtgttggcgctggcgagcgac
gacttatcggaacggacagcaatcttcttccgagtcttccgccgtgcggatggatattcg
accttgatgtgcagcgatcatagcaggtcatcattgaggcaccatctcgacaaagccacg
ttcggaacgtttcttgacattgatccgagatacgaaaacatctctttacgatgcttgatc
gatcgctcggtgatagaaagctacggaggaggggggaggagtgtgataacaagtagggtt
tatccgaaactggcgattggggaagaagctcatctttatgtgttcaacaatggaactaag
agtgtcgttccatcttctttggaagcctggagcgtgcaaaatgcccaaatcaattccatt
gaatttgttgcagaatttttaaatatgtaa

DBGET integrated database retrieval system