KEGG   Tarenaya hassleriana (spider flower): 104812953Help
Entry
104812953         CDS       T04125                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
thj  Tarenaya hassleriana (spider flower)
Brite
KEGG Orthology (KO) [BR:thj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104812953
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     104812953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 Pyr_redox_3 EF-hand_7 EF-hand_8 NAD_binding_7 p25-alpha
Motif
Other DBs
NCBI-GeneID: 104812953
NCBI-ProteinID: XP_010538689
Position
Unknown
AA seq 583 aa AA seqDB search
MRSFSFYERFSRAFHDHPSLSRILVISTISGGGLIAYSEANASYGTNGVAPVETGTRKKK
VLLLGTGWAGTSFLKNLNNASYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIG
RKKSIDMSYLEAECFKIDPQSKKVYCRSKQGLDSNGKKEFSVDYDYLVIATGAQSNTFNI
PGVEENCHFLKEVEDAQGIRRNVIDSFEKANIPELSDEERKRILHFVVVGGGPTGVEFAA
ELHDFVNEDLVKLYPRVKGLARITLLEAADHILTMFDKRITEFAEEKFKRDGIDVKLGSM
VTKVNDKEISAKTKGGEVSSIPYGMIVWSTGIGTRPVIREFMKQIGQGNRRALATDEWLR
VEGCDNIYALGDCATINQRKVMEDVSAIFKKADKDNSGTLTVKEFQGVIDDICVRYPQVE
LYLKSKRMRDIADLLKQAQADDGSKKPIELNIEEFKSALSQVDSEVKFLPATAQVAAQQG
SYLATCFNRMDECENNPQGPIRIRGEGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWVS
IGQTSQWLWYSVYASKQVSWRTRVLVVSDWMRRFIFGRDSSRI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtttcagcttctacgagagattctccagagctttccatgatcatccttctctc
tccaggattctcgtcatctccacgatcagtggtggaggacttattgcctattctgaagcg
aatgcctcctatggcacgaatggtgttgctccggttgaaactggaacaaggaagaaaaaa
gtactgcttctcggaactggatgggctggaaccagtttcttgaagaatctgaataatgcc
tcatatgaggttcaggttatatcgcctcggaactactttgcattcactcccctgctacca
agtgttacctgtggaactgttgaagctcgcagtattgtcgaacccatccgcaacatcggt
agaaagaaaagcattgatatgtcttacttggaggcagaatgtttcaaaatcgatccacag
agcaagaaagtttactgtcgatctaagcaaggccttgattcaaacggaaagaaggaattt
tcagttgactatgactaccttgtaattgcaactggagctcagtctaacacattcaacatt
ccaggggtggaagagaactgtcatttcctgaaagaagttgaagatgcccagggaatccgt
agaaatgtcatcgattcctttgagaaggcgaatatacccgaactaagtgacgaagagaga
aagagaatcctacattttgtggttgttggtggtggaccaacaggtgttgaatttgccgcg
gagcttcatgattttgtcaatgaggatcttgtcaagctatatcctagagtcaagggtttg
gcacgaatcacacttctggaggcagcagaccacatcctgaccatgtttgacaaaagaatc
acagagtttgctgaagaaaagtttaaaagggatggtattgacgtgaaactgggttccatg
gtgaccaaagtgaacgataaggaaatctcggccaaaaccaaaggcggagaggtttcttct
attccttacggaatgattgtctggtcaactggtatcggaacccgtcctgtgataagagaa
tttatgaaacagattggacagggcaacagacgtgctttggcaactgatgaatggcttcgg
gtggaaggatgtgacaatatatacgcccttggtgattgtgcgacaattaaccagcgcaaa
gtcatggaagacgtttccgccattttcaagaaagcggacaaggacaattccgggacgcta
accgtaaaagaattccaaggagtgatagatgacatatgtgtcagatacccgcaggtggag
ctctacctgaagagcaagcgcatgcgagacatagccgatcttctgaaacaagcccaagct
gacgatggttccaagaagcccatcgaattgaacattgaggaattcaagtcggctctctcg
caggtcgactcggaagtgaagtttcttcctgccacagcacaggtagctgctcagcaaggt
tcgtacctagcaacatgcttcaaccgaatggacgaatgcgagaacaatcctcaaggtccc
ataaggatcaggggagaagggcgtcatcgtttccgtcccttcaggtatcgacatctcggg
caatttgcgccactaggaggggagcagacggcggcacagcttccgggagattgggtttcg
ataggacagaccagccagtggctgtggtactctgtctacgccagtaagcaagtgagttgg
cggacgagagtgctggtggtgtcggactggatgaggcgattcatcttcggtagggattcg
agtcgcatctag

DBGET integrated database retrieval system