KEGG   Tarenaya hassleriana (spider flower): 104819089Help
Entry
104819089         CDS       T04125                                 

Definition
(RefSeq) polyamine oxidase 1
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00330  Arginine and proline metabolism
thj00410  beta-Alanine metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    104819089
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104819089
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     104819089
    1.5.3.16  spermine oxidase
     104819089
    1.5.3.-  
     104819089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO GIDA Pyr_redox_2 Pyr_redox_3 Thi4 FAD_binding_2 FAD_binding_3 FAD_oxidored HI0933_like Shikimate_DH Pyr_redox AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 104819089
NCBI-ProteinID: XP_010547285
Position
Unknown
AA seq 501 aa AA seqDB search
MSFMDTSSSSASVIVIGAGISGISAAKVLAENGVRDVLILEATDRIGGRIRKESFGGVSV
ELGAGWIAGVGGKESNPVWELASRFNLRTCFSDYSNARYNIYDRSGKIIPNGLATDLYKK
AVNSAIQKLKSLESNRDDDICKAAEAPSSPTTPIELAIDFILHDFEMAEVEPISTYVDFG
EREFLVADERGYEHLLYKMAEEFLYTSEGKILDNRLKFNRVVREVQHSRNGVVVKTEDGS
VYEANYLIVSASIGVLQSNLISFKPSLPRWKTEALHKCDVIVYTKIFLKFPYCFWPCGPG
KEFFIYAHERRGYYTFWQHMENAYPGSNLLVVTLTNGESKRVEAQSDRETLREAMSVLRD
MFGPNIPNATEILVPRWWNNRFQRGSYSNYPIISDNQLAKNIKAPVGRIFFTGEHTSEKF
SGYVHGGYLAGISTSKSLLEEMEEKERRNENSSFLLEPLLAFTESLSLTTQTDSKVSNLH
KCDIPNQFYLSQKLGIPEAIL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcatggatacgtcgtcgtcgtcggcctccgtcattgtcataggcgctggaatc
tctggtatttcggcggcaaaggtgctcgcggagaacggagtacgagacgtgttgattctg
gaggcaacggaccgaatcggcgggaggatccggaaggagagcttcggcggcgtgtcggtg
gagctcggtgccggttggatcgctggagtcggaggtaaggagtcgaatcctgtgtgggag
ctggcttcgaggtttaatcttcgtacgtgcttctccgattacagcaatgcccgttacaat
atctacgatcggagtggaaaaatcatcccgaatggactggctactgacttgtataagaag
gctgtcaactcggctattcagaagctgaagagcttggagtctaaccgtgacgatgatatc
tgcaaagccgccgaagcaccttcgtcaccgacgacgccgatagaacttgccattgatttt
atcctacatgatttcgagatggcagaggttgagccaatatcaacgtatgtggactttggt
gagagggaatttttggttgctgacgaaagaggctacgaacatttgctgtacaagatggct
gaagaatttctttatacatctgagggtaaaatcctggacaatcgactcaaattcaatagg
gttgttagggaggtacaacactcgaggaatggggtcgtagtgaaaacagaggatggttcc
gtatacgaagctaattatttgatcgtgtctgctagtattggagttctccaaagcaatctc
atttccttcaagccctctttgcccagatggaaaaccgaagcattacacaaatgcgatgtg
atcgtgtacacgaagatcttcctcaagtttccgtactgtttctggccttgtggtccgggt
aaagagttcttcatctatgcacatgaacgacgaggctactacacattttggcagcacatg
gaaaatgcttatccaggctccaatcttctcgtcgtgacgttgaccaatggggaatccaag
cgtgtggaagctcagtccgatcgtgagactctcagagaagcaatgtctgttctaagagac
atgtttggtccgaacatacccaatgccacagagattctcgtcccaagatggtggaacaac
cggttccaacgcggcagttacagcaattacccgattatttccgataaccagctcgctaaa
aacattaaagccccggttggcaggattttcttcactggtgaacatacgagcgagaagttc
agcggatatgttcatggtggatatctcgcaggtatcagcacgagtaaatcgttgttggaa
gagatggaggagaaagagagacggaacgagaactccagcttcttgttagagccattgctt
gccttcaccgagtcgctatctttgacgacgcagaccgactccaaagtctcgaacctccac
aaatgcgacatcccgaaccagttttacctcagccaaaagctcggaatccccgaggcaatc
ttatga

DBGET integrated database retrieval system