KEGG   Tarenaya hassleriana (spider flower): 104821293Help
Entry
104821293         CDS       T04125                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase kinase 1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
thj  Tarenaya hassleriana (spider flower)
Brite
KEGG Orthology (KO) [BR:thj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:thj01001]
    104821293
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104821293
Protein kinases [BR:thj01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   104821293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like FTA2 RIO1 APH
Motif
Other DBs
NCBI-GeneID: 104821293
NCBI-ProteinID: XP_010550413
Position
Unknown
AA seq 284 aa AA seqDB search
MTCSQTLHNNLNKYQICEEIGRGRFGTVTRVYAPSTGDLFACKTIDKASLADDALDRACI
DNEPKLMALLSPHPNIVQIHDLIDTVDSVSIVMELVDPAVTIYDRLVSSGPFSEAQTASY
ARQILSAVSHCHRVGVVHRDIKPENILVDLRNDMVKICDFGSGIWLGEGETTVGVVGTPY
YVAPEVLTGRPYADKVDVWSVGVVLYTMLAGAPPFYGETAEEIFEAVIRGNLRFPPKIFR
GISSSAKDLLRKMICRDVSRRFSAEQALRHPWIVNAGETDASFI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacttgcagccaaacactccacaacaacctcaacaagtaccaaatctgcgaagaaatc
ggtcggggtcggttcggcaccgtcacgcgcgtgtacgcgccgtcgaccggagatctcttc
gcctgcaagacgatcgacaaggcttctctcgccgacgacgcgcttgaccgcgcgtgcatc
gacaacgagcccaagctcatggctctgttgtctccacacccaaacatcgtccaaatccat
gacctaatcgacacagtcgattccgtctccatcgtcatggagctcgtggatccggcggtc
acgatctacgaccgcttggtctcctccggtcccttctctgaggcccaaacggcgtcgtac
gcgaggcagatcctctccgccgtgtcgcattgtcaccgagtcggtgttgttcatagggat
atcaagccggagaatattctggtggatctgagaaacgacatggtgaagatctgcgatttt
gggtctgggatttggttgggtgagggcgagaccaccgtaggcgtcgtgggtacgccgtat
tacgtggctccggaggttctgacggggaggccgtacgccgataaagtcgatgtctggagc
gtcggcgtcgttctttacactatgctcgccggagctcctccgttctacggtgaaacggcg
gaggagatattcgaagctgtgatccgcgggaatcttcggtttcctccgaagattttccgg
gggatttcgtcttctgcgaaagatttattgaggaagatgatctgcagggatgtttctaga
agattttcagctgaacaggcactaaggcatccatggattgtaaatgcaggtgaaactgat
gccagcttcatctga

DBGET integrated database retrieval system