KEGG   Tarenaya hassleriana (spider flower): 104823375Help
Entry
104823375         CDS       T04125                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00010  Glycolysis / Gluconeogenesis
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104823375
Enzymes [BR:thj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     104823375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 104823375
NCBI-ProteinID: XP_010553236
Position
Unknown
AA seq 610 aa AA seqDB search
MDTKVGSIDSCIPASNDIGGSPNCGVSTIESSPTSHSPAVVSPSDATLGRHLARRLVEIG
VTDVFSVPGDFNLTLLDHLIAEPRLKLIGCCNELNAGYAADGYARSRGVGACVVTFTVGG
LSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQEFRCFQTITCYQAV
INNLEDAHELVDTAISTALKESKPVYLSVSCNLPAIPHPTFSRHPVPFSLTPKVSNQMGL
EAAVEAAAEFLNKAVKPVMVGGPNMRVAKAMEAFVELADASGYALAVMPSAKGLVPENHP
HFIGTYWGAVSTPFCEEIVESADAYVFAGPIFNDYSSVGYSLLLKKEKAIIVQPEGVTVG
NGPSFGCVLMKDFLSHLAKRLAHNNTAYKNYHRIYVTEGKPLRDNPKEPLRVNVLFQHIQ
RLLNGETAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVI
ACIGDGSFQVTGQEVSTMIRMGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDA
IHNGEGKCWTAKVRSEEELVEAIEMATEEEEKREGLWFIEAIVHRDDTSRELLEWGSRVS
SANSRPPNPQ
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggatactaaggtcggatccatcgactcttgtattccggcgtccaatgacatcggcggc
tctcccaactgcggtgtttccaccatcgagagctctccgacgtcacactcccccgccgtc
gtcagtccgagcgacgcgacgctcggtcgccacctcgcgaggcggctcgtggagatcggc
gtcaccgatgtcttttccgttcccggagactttaacctgacgcttctcgaccacctgatc
gccgagccaaggctcaaactcatcgggtgctgcaacgagctcaacgccgggtacgccgcc
gacggttacgctaggtcgcgcggcgtcggcgcttgcgtcgttacgttcaccgtcggcggt
ttgagcgtcctgaacgcgatcgccggcgcttacagtgagaatctgcctgtgatttgtatc
gtgggcggccccaactccaacgattatgggactaacaggattcttcatcacaccattggc
ttacctgatttcagccaggaattccggtgcttccagacaatcacttgttatcaggctgtg
atcaacaacttggaagatgctcacgagctcgtcgatactgcgatttcgactgctctgaaa
gaaagcaaacctgtttacttaagtgtaagctgcaacttgcctgcaattcctcatccgact
ttcagtcgccatcccgttccattctcgcttactcccaaggtgagtaaccagatgggtcta
gaggctgcggtagaggcagctgccgagttcttgaacaaagctgtgaaaccagtaatggtg
ggtggaccgaatatgcgagttgcaaaggctatggaagctttcgtcgagctagctgatgcg
tctggatatgcccttgctgtaatgccgtctgccaagggactggtacccgagaaccacccg
catttcatagggacgtactggggagcggtcagcactcccttctgcgaggagattgttgaa
tcagcagatgcgtacgtgtttgcgggtcctattttcaacgattacagctcggtcggatac
tctctccttctcaagaaggagaaagcaatcatcgtgcagccagagggtgttacggtaggg
aacgggccttcattcgggtgtgttcttatgaaagatttccttagccatttggcgaagcga
ttggcacataacaacacagcctacaagaactaccacaggatctatgtgacggaagggaag
cctttgagagataacccgaaggagccgttgagggttaacgtgctgtttcagcatatccag
aggttgctgaatggggaaaccgctgtgattgctgaaacgggagattcctggttcaactgt
cagaagctgaagctgccggagggatgcgggtacgaattccagatgcagtacggatcgata
gggtggtcagtgggagcaacgctgggatatgcgcaagcagtaccggagaagcgtgtgata
gcatgcataggagacggtagtttccaggtgacgggacaggaggtgtcgacgatgataagg
atggggcagaagagcataatatttctgataaacaacggagggtacacgatcgaggtagaa
atccacgacggcccgtacaacgtcataaagaactggaactacaccgcgcttgtggacgcc
atccacaacggggaaggcaagtgctggacggccaaggtgagaagcgaagaggagctggtg
gaagcgatagaaatggcgacggaggaagaggagaagagagaggggctgtggttcatagag
gcgatagtgcacagggatgatacgagcagagagctgctggaatggggatctcgtgtctcc
tctgccaacagccgcccccctaaccctcagtag

DBGET integrated database retrieval system