KEGG   Tarenaya hassleriana (spider flower): 104823833Help
Entry
104823833         CDS       T04125                                 

Definition
(RefSeq) mitogen-activated protein kinase 17-like
  KO
K20538  mitogen-activated protein kinase 8 [EC:2.7.11.24]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:thj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    104823833
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:thj01001]
    104823833
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104823833
Protein kinases [BR:thj01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104823833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like Herpes_ICP4_N
Motif
Other DBs
NCBI-GeneID: 104823833
NCBI-ProteinID: XP_010553884
Position
Unknown
AA seq 471 aa AA seqDB search
MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAVCPHTGEKVAIKKMTNVFEHVSDAIRI
LREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMESDLHHVLKVNDDLTPQHHQ
FFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKLKICDLGLARVSFTDSPSAVFWTDY
VATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTGTPLFPGKNVVHQLELVTDLLGT
PSPETITRIRNEKARKYLSNMRRKEPVPFSQKFLNVDPVALRLLQRLIAFDPKDRPSAEE
ALADPYFEGLANVVYEPSRKPISNLEFGFERRKLSGEDVRELMYREILEYHPQMLQEYLH
GEEHINSHFLYPSGVEQFKQQFARLEEQHDKDEGNSPPVQRKYSSLPRERVCSPEDQRVT
SPSKTPNETEAQRMQEKAAPLKRSGCLLRSDSICASTCVAAAKDCDVLLVK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaaggagtttttcacggagtatggagaagccagtcagtatcagatacaggaa
gtggtcggaaaaggaagctacggcgttgtagcctcggccgtgtgcccgcacacgggagag
aaagtggcgataaagaagatgacgaacgtgttcgaacacgtgtccgacgccatacggata
ctcagagagataaagctcctcagacttttaagacatcctgacatcgtggagataaagcac
ataatgctgcctccttgtcggaaggaattcaaagatatttatgtagtttttgagttgatg
gaatcggatcttcaccacgtccttaaggtaaatgacgacctcactcctcagcatcatcaa
ttcttcttgtaccaacttctccgtggtctcaagttcatgcactcggctcatgttttccat
agagacctgaagcccaagaacatccttgctaatgctgactgcaaactcaagatttgtgac
cttgggctcgctcgggtctctttcaccgattccccttcagctgttttctggactgactac
gttgctacgagatggtatcgtgctcccgagctctgtggttctttctattctaactacaca
ccggcaattgacatgtggagcgtcggctgcatatttgcggagatgctcactggaacaccc
ttgtttccgggcaagaacgttgtgcatcagcttgaacttgtcactgatcttcttggcact
ccgtccccggaaactataacaaggattcggaatgagaaggctagaaagtatttaagtaac
atgaggcgaaaggaacctgttcctttctcccaaaaattcctcaatgtcgatcccgtggct
ctgcgtctgcttcagcgtttgatcgcgtttgacccaaaggaccgtccctctgcagaagag
gcgttggctgatccgtattttgaagggttggcaaacgtggtgtacgaaccctcaaggaag
ccgatatccaatcttgaattcgggtttgagaggaggaaattgagcggggaagatgttaga
gagctcatgtacagagagatattagagtatcatccacagatgctgcaagagtatctgcat
ggagaagagcacatcaactctcattttctatatccaagcggagtagaacagttcaaacaa
cagtttgcccgtctcgaagaacaacatgataaggacgaaggaaactccccgccggtccaa
agaaagtactcatctctccccagggaacgcgtctgctcaccggaagatcaaagggtgaca
tcaccttcaaagactccaaacgaaacggaagcacagaggatgcaggagaaagcggctcct
ctgaaacgctctggatgtctcctgagaagcgatagtatctgcgcttcaacatgcgtggca
gccgccaaagattgtgacgtactactggtcaagtga

DBGET integrated database retrieval system