KEGG   Tarenaya hassleriana (spider flower): 104826882Help
Entry
104826882         CDS       T04125                                 

Definition
(RefSeq) probable protein S-acyltransferase 3 isoform X1
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
thj  Tarenaya hassleriana (spider flower)
Brite
Enzymes [BR:thj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104826882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 104826882
NCBI-ProteinID: XP_010558121
Position
Unknown
AA seq 422 aa AA seqDB search
MNSLMFVYVRKTWMIWFCHVCVMIVDDMKLHIFHEDSLVKKHAYIQMMRGLIKIFCCGGM
LIFGPDASSLFLTSLLIGAPALTFCIRMLVWIRNGDPSFNYPVLTCGFVLTFLDFTFLLL
TSSRDPGIIPRNKQPPAMDDDSSDGYMTQSKEWVNSKTPNLKIPKTKDVFVNGNTIKVKF
CETCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIAVRNYPFFICFISCSTLLCIYVFV
FSWFNLLRQPGRLWRIMAHDIVSVILIVYTFVVVWFVGGLTVFHFYLISTNQTTYENFRY
RYDRKENPYKKGLLKNLKEVLFTNIPPSQINLRAWVPDYEDMTTVSVMSEFDSDFSTNRK
YDIEIGGDMLSKDESKKMLASTMRTLDHNDIHDDRLKKVGDDSPEFDPSFFLPQPELHKH
LP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttgatgtttgtttacgtgagaaaaacgtggatgatttggttttgccatgtg
tgtgtcatgattgttgatgatatgaagctgcatatctttcatgaggattccttggtgaaa
aaacatgcatatattcaaatgatgcgtggcttaatcaagatattttgctgtggtggaatg
ctaatcttcggtccggatgcatcatctctgtttctaacctcgctcctgatcggagctcct
gcacttacattctgcataaggatgcttgtatggatcagaaatggtgacccatccttcaac
tatcccgtcctgacctgtgggtttgtcctcacattcttggattttacatttctcttgtta
acatcgtctagagatccaggaatcatccccaggaataagcaaccacctgcaatggatgat
gacagttcagatggttacatgacacaatctaaggaatgggtgaacagcaaaacaccaaac
ctcaagataccgaagaccaaagatgtgtttgttaacggcaacaccatcaaagtgaagttc
tgtgaaacttgtttgttgtaccgtccaccacgagcttctcattgttccatctgcaacaac
tgtgtccaacgctttgatcaccactgtccttgggtaggacagtgtattgcagtgcggaat
tacccgttcttcatctgtttcatatcatgctcaaccttgttgtgcatatatgtgttcgtc
ttctcgtggttcaatctgctccggcagccaggccgattatggaggatcatggcccatgat
atagtctctgtcattctcattgtctataccttcgttgttgtctggttcgtgggtggtctt
acagttttccatttctatctgatctccacaaaccagacaacatacgagaatttcaggtac
cgttacgataggaaggaaaacccttacaagaaagggctactgaagaatctcaaggaagtc
ttgttcaccaatatcccaccttcacagataaacctccgagcatgggtaccggattatgaa
gatatgacaactgtatctgtcatgtctgaattcgattcagactttagcacaaacaggaaa
tacgatatcgaaataggaggcgacatgctaagtaaggacgagagtaagaagatgcttgcc
tctacaatgcgaaccttagatcacaatgacattcatgatgacagattgaagaaggttgga
gatgattctcccgagtttgatccgtctttcttcctgcctcaaccggaactacacaagcat
ttaccgtga

DBGET integrated database retrieval system