KEGG   Thauera sp. K11: CCZ27_18115Help
Entry
CCZ27_18115       CDS       T05106                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
thk  Thauera sp. K11
Brite
KEGG Orthology (KO) [BR:thk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:thk03009]
    CCZ27_18115
Enzymes [BR:thk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CCZ27_18115
Ribosome biogenesis [BR:thk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CCZ27_18115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_9 Ubie_methyltran MTS Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ATE61620
UniProt: A0A290ZRI5
Position
complement(4138960..4139823)
Genome map
AA seq 287 aa AA seqDB search
MYIVPFQSLACPLDGAPLQRSGSAWRCPSGHSFDVAREGHTNLLPVQNKRSRDPGDSKEM
VAARRRFLNAGGYQPIAAAVARTVLRHLPPAADAACLDAGCGEGYYLRQLAGAAAAAAGD
HTLALLGLDISKWAVLSAAKQFAQAGWVVGSNANLPVRPGAFDCVLCMFGFPVHPEFARV
LKPGGLLLQVDAGPDHLRELREIIYPALKPERPAADAPPPAGFVRLDGEAVRSPLQLAGQ
AQIADLLAMTPHLYRATAEGRARAAALDSLAVTVDVRLAGFERARSA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcgttcccttccagtccctcgcctgcccgctcgacggcgcgccgctgcaacgc
agcggttccgcctggcgctgcccgtcgggccacagcttcgacgtcgcccgcgagggccac
acgaatctgctgccggtgcagaacaagcgctcgcgtgatccgggagacagcaaggagatg
gtcgccgcgcgcaggcgcttcctgaatgccggcggctaccagcccatcgccgcggcggtc
gcgcgcaccgtgctgcggcacctgccgcccgccgccgacgcggcctgcctcgacgccggc
tgcggcgaaggctactacctgcgccagctcgccggagcggcggccgcggccgcaggcgac
catacgctggcgctgctcgggctggacatctcgaaatgggcggtgctgtcggcggcgaag
cagtttgcgcaggccggctgggtggtgggcagcaacgccaacctgccggtgcggccgggc
gcgttcgattgcgtgctgtgcatgttcggctttccggtccatccggagttcgcccgcgtg
ctgaagccgggcgggctgctgctgcaggtggatgccggccccgaccatctgcgcgaactg
cgcgagatcatctatcccgcgctgaaaccggagcgtccggcggccgatgccccgccgccg
gcgggcttcgtccggctggacggcgaagccgtccgctctccgctgcaattggccggccag
gcgcagatcgccgacctgctggcgatgacgccgcacctctaccgcgccaccgcagagggc
cgcgccagggctgcggcgctggattcgctggcggtcaccgtggatgtgcggctggccggc
ttcgagcgtgcccgttcggcatga

DBGET integrated database retrieval system