KEGG   Tetragenococcus halophilus: TEH_00240Help
Entry
TEH_00240         CDS       T01640                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:thl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TEH_00240 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thl01007]
    TEH_00240 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thl03016]
    TEH_00240 (cysS)
Enzymes [BR:thl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     TEH_00240 (cysS)
Amino acid related enzymes [BR:thl01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TEH_00240 (cysS)
Transfer RNA biogenesis [BR:thl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TEH_00240 (cysS)
 Prokaryotic type
    TEH_00240 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 tRNA-synt_1d COBRA1 tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 11261057
NCBI-ProteinID: BAK93351
UniProt: G4L3N5
Position
28596..30005
Genome map
AA seq 469 aa AA seqDB search
MIKIFNTLTRKKEEFQPITAGKVKMYVCGPTVYNYIHIGNGRSTVSFDTIRRYLEYRGYE
VNYVSNFTDVDDKIIRAAKELKISTPEVAERFIKAFEQDTTKLNVKPANHHPRVVNYMQA
IIDFIQVLLDKEYAYVVDGDVYYRTRKFSEYGRLSDQSIDELEVGASKRTGVEQQLKEDP
LDFALWKNAKEGEISWPAPWGEGRPGWHIECSVMATQLLGDTIDIHGGGQDLEFPHHENE
IAQSEAKTGKTFANYWMHNGYVTIGEDDEKMSKSLGNFVTVHDILDKMDPQVVRFFLSTT
QYRRPIRYSQKTLTEANNNLQRLKNTYENAVFRLNDAISSLNDDNNKKDEFKQLIDQFII
EMDDDFNAANGITVVYEMAKWMNRYIEQNTVSYEVLKYALDHFIEILTIFGVEFEEKLAD
KQVEQLILERDEARKNKEFIRSDEIRDQLKEQGIVLEDTPQGTRWRRKT
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatattcaatactttgacaagaaaaaaagaagaatttcagccaataaccgct
ggaaaagttaaaatgtatgtttgtggaccaactgtctataattatattcatataggcaat
ggcaggagtacagtttcttttgatacgattcgtcgttatttggaatatcgtggttatgaa
gttaactatgtatcaaattttacagatgttgatgataaaattattagagctgctaaagag
ttaaaaataagtacacctgaagttgctgaacgttttatcaaagcttttgaacaagatacg
acaaaattaaatgtaaaaccagcaaatcatcatccacgagtcgttaattatatgcaagca
attattgattttattcaagttttattggataaagaatatgcttatgttgttgatggagat
gtttattatcgtacacgtaaattttcagaatatggccgcttaagcgatcaatcaatcgac
gaattagaagttggtgctagtaagcggactggtgtagaacagcaattaaaagaggatcct
ttagattttgctttatggaaaaacgcgaaagaaggagaaatttcctggccagctccttgg
ggagaaggtcgccctggttggcatattgaatgttctgttatggcaacacaactgctaggc
gatacaattgatattcatggtggtggacaggatttagagtttccgcatcatgaaaatgaa
attgcgcaaagcgaggccaaaaccggtaaaacatttgctaattattggatgcataatgga
tacgtgacaattggtgaagatgacgagaaaatgagcaagtcactaggaaattttgtaact
gtacatgatattttggataagatggatccacaagtagttcgttttttcctatctactacg
caatatcgtcgtcctattcgctatagccaaaaaacactaacagaagcaaataataattta
caacgcttaaaaaatacttacgagaatgctgtttttcgcttaaatgatgccataagtagt
ttaaatgatgataataacaaaaaggacgaattcaagcagttaattgatcagtttattata
gaaatggatgacgactttaacgcagcaaatggtattacagttgtttatgaaatggctaag
tggatgaatcgttatattgaacaaaacactgtttcttacgaagtgttaaaatatgcttta
gatcattttatagaaattcttactattttcggtgtggaatttgaagaaaaattagctgat
aaacaagtggaacaattgattttagaacgtgatgaagctcgtaaaaataaagaatttatt
cgtagcgacgaaatccgagatcagttgaaagaacaaggaattgttttggaagatacgcca
caaggaacaaggtggagaagaaaaacatga

DBGET integrated database retrieval system