KEGG   Tetragenococcus halophilus NBRC 12172: TEH_01120Help
Entry
TEH_01120         CDS       T01640                                 

Definition
(GenBank) putative pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
thl  Tetragenococcus halophilus NBRC 12172
Brite
KEGG Orthology (KO) [BR:thl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:thl03009]
    TEH_01120
Enzymes [BR:thl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     TEH_01120
Ribosome biogenesis [BR:thl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    TEH_01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 11261453
NCBI-ProteinID: BAK93439
UniProt: G4L3X3
Position
complement(127860..128714)
Genome map
AA seq 284 aa AA seqDB search
MEYSITLPTFQKTITLRELLETQWLVPRKVRHFLRTRKNVWCNHQPIKFHEMVHANDMIT
LRIEEDDYNYQTVKAGSKENIEVLYEDEHLIVVNKASGVKTHPNQPDETATLLNDLSAYL
GKKNERPYVVHRLDKETSGAILFAKSPLVLPILGRLLEEKKIYRNYQAIVWGKLTQDCTI
DKRIGRDRHDKRKRIISERQGKTAITYVKVHQVYKQTSEVYCSLATGRTHQIRVHLASIG
HPVVGDPLYQNKEEKRLALHAYKIKFLHPFTQEQIEVIAKPGLW
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaatattcaatcactttacctacttttcaaaaaacaataacgcttcgtgaattgtta
gaaacccagtggcttgttcctcgaaaagtgcgtcattttctgcgaacacgtaaaaatgtc
tggtgtaaccatcaaccgataaaatttcatgaaatggtgcatgctaatgatatgattacc
ttgcgaattgaagaagatgattataattatcaaacagtaaaagctggatcaaaagaaaat
atcgaagttttatatgaagatgaacatttaattgttgtcaataaagctagcggggtgaaa
acacatcctaaccaacccgatgaaacagctacgctcttaaatgacctaagtgcttaccta
ggtaaaaaaaatgaacgaccttatgtcgttcatcgcctggacaaagaaacgtctggcgct
atcttgttcgctaaaagtccccttgttctccctattttaggaagactcctagaagaaaag
aaaatctaccgaaactatcaagcaatcgtttggggcaagctaacacaggactgtacaatc
gataaaagaattggtcgtgatcgccatgataaacgcaagcgtatcataagtgaacgccag
ggtaaaactgccattacctatgtaaaagtccatcaagtgtacaaacagaccagtgaagtc
tattgtagcctcgccacaggcagaacacatcaaatacgtgttcatttagcaagtatagga
cacccagttgtaggtgatccactatatcaaaacaaagaagaaaagcgcctagctttacat
gcctacaaaataaaattccttcacccatttactcaggaacaaatcgaggtaatagctaag
ccaggcctttggtaa

DBGET integrated database retrieval system