KEGG   Tetragenococcus halophilus: TEH_07910Help
Entry
TEH_07910         CDS       T01640                                 

Definition
(GenBank) Na(+)-transporting decarboxylase carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00620  Pyruvate metabolism
thl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TEH_07910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thl02000]
    TEH_07910
Enzymes [BR:thl01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     TEH_07910
Transporters [BR:thl02000]
 Other transporters
  Primary active transporters [TC:3]
   TEH_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Amidohydro_1 Bmp His_biosynth
Motif
Other DBs
NCBI-GeneID: 11259442
NCBI-ProteinID: BAK94118
UniProt: G4L6E4
Position
complement(807592..808995)
Genome map
AA seq 467 aa AA seqDB search
MSNKTINFMETVLRDAHQSLMATRMSTEDMLPIVEKLDQAGYTSLECWGGATYDAAIRFL
NEDPWQRLREIRKRAKNTKLQMLLRGQNLLGYRNYADDVVESFVANAAEAGIDIFRIFDA
LNDTRNLKTSLKAVKKANKHAQLVMCYTISTVHTVEYYSKLAQELVDMGADSICVKDMAG
IMTPEVAKELVTELKKVTDIPIEIHTHATSGTSEMTYLASVEAGADIIDTAISPFASGTS
QPASETMAYVLKEYGYNLNVDLDAMEEVAEYFKPIKQKYIDEGIFDYKMMDVEPKALFYQ
VPGGMLSNLYSQLKQANATDKYDEVLKEVPAVRKDLGYPPLVTPMSQMVGTQAVFNVIAK
ERYKMVPNEIKSYLRGEYGQSPAPVDETVRKNIIGDETVMTDRPADHLEPEMESLAAELG
DLAKTEEDVLTYALFSQVGLTYLKNKYSNKPADGKEDDITKIKVTQI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaaccattaatttcatggaaactgtactaagagatgctcatcaaagttta
atggcaaccagaatgtcaacagaagatatgttacccattgttgaaaaactagaccaagct
ggctatacatctctagaatgttggggcggcgctacttatgatgctgctattcgtttttta
aacgaagatccttggcaaagattgcgtgaaattcggaaaagagcgaaaaatactaagctt
caaatgttgttaagaggacaaaacttgctaggttaccgtaattatgctgacgatgttgtt
gaaagttttgtcgccaatgcagctgaagccggcatagatatttttcgaatttttgatgca
ttgaatgatactagaaatttgaagacttcacttaaagcagtcaaaaaagcgaataaacat
gctcagctagtgatgtgttacactatcagcactgttcatacagtggaatattatagtaaa
cttgcccaagaattagttgatatgggcgctgattctatttgtgtcaaagacatggctggc
attatgacaccagaagtcgctaaagaattagtcactgagctgaaaaaagtaacagatatt
ccgattgaaattcacacacacgctactagcggaacttctgaaatgacttatttagcttca
gttgaagccggcgcagatattatcgatacagctatttcaccatttgcaagtggaacaagc
caacctgcttccgaaaccatggcctatgtcttaaaagaatatggttacaacttaaatgtt
gatttagatgcaatggaagaagtagcagaatattttaaacccatcaaacaaaaatatatc
gatgaaggaatctttgattacaagatgatggatgtagaacctaaagctttattttaccaa
gtacctggcggcatgttatccaacctttactctcaattgaaacaagccaacgcaacagat
aaatatgatgaggtattaaaagaagttcccgctgtacgtaaggatctgggctatccgcca
ttagttacaccaatgagtcaaatggtcggtacacaagcggtatttaatgtgattgctaaa
gaacgttacaaaatggtgccaaatgaaattaaaagttatcttcggggcgaatatgggcaa
tctcctgctcctgtagatgaaactgtacgaaaaaatatcatcggcgatgaaacagtcatg
acagatcgtccagcggatcatttagaaccagaaatggaatcattggctgctgagttaggc
gatttagctaaaactgaagaagatgtattaacttatgctttgttctcgcaagttggttta
acttatctaaaaaataaatactctaataaaccagcggacggtaaagaagatgacattaca
aaaattaaagtaacgcagatataa

DBGET integrated database retrieval system