KEGG   Tetragenococcus halophilus NBRC 12172: TEH_14140
Entry
TEH_14140         CDS       T01640                                 

Gene name
hprA
Definition
(GenBank) putative glycerate dehydrogenase
  KO
K00018  glycerate dehydrogenase [EC:1.1.1.29]
Organism
thl  Tetragenococcus halophilus NBRC 12172
Pathway
thl00260  Glycine, serine and threonine metabolism
thl00630  Glyoxylate and dicarboxylate metabolism
thl00680  Methane metabolism
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
thl01120  Microbial metabolism in diverse environments
thl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TEH_14140 (hprA)
  09102 Energy metabolism
   00680 Methane metabolism
    TEH_14140 (hprA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TEH_14140 (hprA)
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     TEH_14140 (hprA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh XdhC_C NAD_binding_2 AdoHcyase_NAD IlvN
Other DBs
NCBI-GeneID: 11259930
NCBI-ProteinID: BAK94741
UniProt: G4L867
Position
complement(1420784..1421749)
AA seq 321 aa
MKIVILDGYSLNPGDIDWEPLKEIGECEIYDRTSFTDKKEILQRIGDARIVLTNKTPLDE
EVLNAAPNLEYIGILATGYNIIDIDAATKAGITVTNVPAYGTEAVAQFTFALLLEITSQV
GLHNRLVHEGQWSSNPDFSFFATPLTELQGKTLGLVGFGRIAQKVAEIGHAFGMKVIFYN
HRPKNVKAEWLQQVSLNELLIQSDVVSLHVPQTPDTKELINSSSLQKMKNTGILINTARG
GLINEADLAEALNNEQLAVAAMDVAQQEPINEDSPLLAAKNCYITPHIAWAPQETRKRLL
DIVASNLTEFLAGRKQNTVTS
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaaaattgtcattttagatgggtactctttaaatcctggcgacattgattgggaacca
ttaaaagaaataggcgaatgtgaaatatatgatagaacgtcatttactgataaaaaagaa
attttgcaacgaatcggtgatgcgcggattgttttgacgaataagacacctttggatgaa
gaggtccttaatgctgcacctaatttagagtatataggtatcttagctactggttacaat
attatcgatattgatgcagcaactaaagctggaattacagtaacgaatgttccagcatac
gggacagaggcggtcgctcaattcacatttgctttgttgttggaaatcacaagtcaagtc
ggtttacacaatcgtctggtacatgaaggacaatggtcgagcaatcctgattttagtttt
tttgccacaccgctgacagaactacaaggaaaaacgctagggcttgttggcttcggacga
attgctcaaaaagtggctgaaattggtcatgcatttggcatgaaagtcatcttttataac
catcgtcctaaaaatgttaaagctgaatggttacaacaagtgagcctaaatgaactatta
atccagtctgatgtcgttagcttgcatgtaccgcagactcctgatacaaaagagttgatc
aacagctcctcactgcaaaaaatgaaaaatactgggattttgattaatactgcgcgtggt
ggtttgattaatgaagcagaccttgctgaagccttaaacaacgaacaacttgccgtagca
gccatggacgtagctcaacaggagcccatcaatgaagatagccctttactagcagctaag
aattgttacattacaccacacatagcctgggcaccacaagaaacaagaaaacgattatta
gatattgtcgctagtaatttaacagaatttctagcaggtcgaaagcaaaatacagtgact
agttaa

DBGET integrated database retrieval system