KEGG   Tetragenococcus halophilus: TEH_15450Help
Entry
TEH_15450         CDS       T01640                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00520  Amino sugar and nucleotide sugar metabolism
thl01100  Metabolic pathways
thl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TEH_15450 (nagA)
Enzymes [BR:thl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     TEH_15450 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 NAD_binding_3 DUF179
Motif
Other DBs
NCBI-GeneID: 11260012
NCBI-ProteinID: BAK94872
UniProt: G4L8J8
Position
complement(1562887..1564035)
Genome map
AA seq 382 aa AA seqDB search
MREFLAADRFFFASHVEDKGYLEIVDGKFGQYYKTLPDEKVNIIDQSGKWIAPGLVDTHI
HGFKNHDVMDNDAQGMNEISEGLLSCGVTSFLPTTLTSSRKHLKDVAKMLGEVKGSEKGA
KIQGIYFEGPFFTEEHKGAQNPAYFSDPDTDTFHEWQEASGGIIKKIALAPERDGVEDFV
KQVSDEDVVVSLGHSSATFQQASSAVEAGADVFVHAYNGMSGLNHREPGMVGALLTLNDV
YAELICDGYHVHPKAAELLIQKMGYNRVSLITDCMMAGGMPDGDYILGEFPVVVKDGTAR
MKEGNLAGSILKLKEGVKNVVDWNIATPEQAITMGSLVPAISSNIDDSCGRIKKGRAADF
IVLNPDMTLSATYLDGQERYHA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatttctagcagcagataggttttttttcgcgtcccatgttgaagataagggt
tatttagaaattgtagatggaaaatttggacaatactataaaacacttcccgacgaaaaa
gtaaatattattgaccaaagtggtaaatggatcgcacctggtttagttgatacacatatt
cacggcttcaaaaatcatgatgtgatggataatgatgcacaaggaatgaatgaaatttca
gaagggctactttcttgtggcgtgacttcctttttaccaacaaccttaacttcaagtaga
aaacatttaaaagatgtagctaaaatgttaggagaggtaaaaggtagcgaaaaaggagct
aaaattcaagggatttattttgaaggtcctttttttacggaagaacacaaaggcgcacaa
aatcctgcttactttagtgatccggatactgatacttttcatgaatggcaagaagcttct
ggaggtattattaaaaagatcgcgcttgcgcccgaaagagatggtgtagaagatttcgtt
aaacaagtcagtgatgaagatgtggttgtatctttgggccacagtagtgctacttttcaa
caagcatcttctgcggttgaagcaggcgctgatgtttttgtccatgcttataatggcatg
agtggtttgaatcatcgtgaacctgggatggtaggtgccttgttaacattaaacgatgtg
tatgctgaactgatttgcgatggctatcatgttcatcctaaagcagcagaattgcttatt
caaaaaatgggctataatcgtgtttctttaattacagattgtatgatggctggaggaatg
ccagacggcgattatattctaggagaatttccagtagttgttaaagatggtacagctaga
atgaaagaaggaaacttagctggaagtattttgaagctaaaagagggtgtgaaaaacgtt
gtagattggaacattgccacaccagagcaggcaattacaatgggaagcttggttccagca
attagctcaaatattgatgatagctgtggaagaattaaaaaaggtagagctgcggacttt
attgttttaaatccagatatgaccttgagtgctacttatttggatggacaagaaagatat
catgcttaa

DBGET integrated database retrieval system