KEGG   Tetragenococcus halophilus: TEH_20240Help
Entry
TEH_20240         CDS       T01640                                 

Gene name
mvaE
Definition
(GenBank) acetoacetyl-CoA thiolase/3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00900  Terpenoid backbone biosynthesis
thl01110  Biosynthesis of secondary metabolites
thl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TEH_20240 (mvaE)
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     TEH_20240 (mvaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 11260338
NCBI-ProteinID: BAK95351
UniProt: G4L2M2
Position
complement(2022013..2024439)
Genome map
AA seq 808 aa AA seqDB search
MKDVVIIDALRTPVGKYQGSLSQLSAVELGSAVSKKLINNNKKAAAAINQVIFGNVLQAG
SGQNPARQITLNSGLSESVYASTINEVCGSGMKAISLASQAIFLDEAEVVLAGGTESMSQ
APYLSYYNQQEDTYSQPKPAMLSDGLTDVFSGQHMGLTAENVAEKFNITRKMQDAFALRS
QERAANAQEKGYFSNEILPLDIAGKKVDKDEGVRKDTSLEKLAKLKTVFKKEGTVTAGNA
STINDGASAVLLASKNFALANDLSYLAVLKDVVEVGVDPKVMGISPIKAIRQLLERNALA
IENIDLFEINEAFASSSIAVEQELEIPEDKVNVCGSGISIGHAIGASGARIITTACHQLE
RVDGRYAVVSLCVGGGLGLAALIERPKANKSHKFYQLTRKERLDFLVSHNKITSKTVDEL
ERTVLPESIAGNLTENQMSEISLPMGLVSNMSVNQKDYFVPMATEEPSVVAACNNGVQMA
KSSGGFTAVMKKKEIRGQIVLMNVTDKSTVIEQIEKNEAEIISTAEQSYPSIVKRGGGVK
RVVVREFAEDPNFLSVDLIVDTQDAMGANMLNTMLEAVATLFRQWFSEEILFSILSNYAT
DALVSAECYISFASLGKGDAEKGEKIAEKIAAASNFAQIDPFRAATHNKGIMNGIDAVVL
ATGNDTRSVNSAVHAYAAKNGKYQGLSQWEIVDNQLKGSIELPLAVATAGGATKVLPKAQ
AALQILDVNDAKELAEVIASVGLAQNLAALKALVTEGIQKGHMALQARTLALSVGAKDSE
VQKVANRLKRQQMNEENARKILQELRNR
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagatgttgtaattattgatgctttgagaactcctgttggtaaatatcaaggatct
ttaagtcaattatcagctgtagaactggggtcagctgtgtctaaaaaacttataaataat
aacaaaaaagcggctgctgcaatcaatcaagttatttttggtaatgtgttacaagcgggc
agtgggcaaaacccagccagacaaattaccttaaatagcggattatctgaaagcgtgtat
gcttctacgattaatgaagtttgtggttcaggaatgaaggccatctcgctagcttcacaa
gctattttcttagatgaagcggaagtggtattagctggtggcactgaaagtatgagtcag
gcgccttatttaagttattataaccaacaagaagatacatattcgcaacctaaaccagct
atgctttctgatggtttaaccgacgtttttagtggccaacatatgggtcttactgctgaa
aatgtagcagaaaaatttaatatcacaagaaaaatgcaggatgcatttgcgctacgttca
caagaaagagcggctaatgctcaggaaaaagggtatttttctaatgaaatactgcctctt
gatatcgctggaaaaaaggtagataaagatgaaggtgtgagaaaagatacttctctggaa
aaactagcaaaattaaaaacggtatttaaaaaagaaggaacagtaacagcggggaatgct
tctacaattaatgatggagcgtcagctgtacttcttgcttcaaaaaattttgcgttagca
aatgatctttcctatttagcggttcttaaagatgtggtggaagtaggagttgatcctaaa
gttatgggaatttctcctatcaaagctattcgtcagttgttagaaagaaatgcattagca
atagaaaatatcgatctttttgagatcaacgaagctttcgcatcctcttctattgctgtg
gaacaagaattagagatacctgaagataaagtcaatgtttgtggaagtgggatttctata
ggacatgcgattggagctagcggtgctcgtattattacaacagcttgtcatcagttagaa
cgtgtggatggacgttatgctgtggtgtcattatgtgtaggtggaggtcttggactggcg
gctttaattgaacgacctaaagctaataaatctcataagttttatcaactaacgagaaaa
gaaagactagatttcttagtctctcataataaaataactagtaaaaccgttgatgaacta
gaaagaaccgttttgccagaaagtattgcgggcaatttaacggaaaatcaaatgagtgaa
atttcacttcctatgggactagtttccaatatgtctgttaaccaaaaagattattttgtt
cctatggcaaccgaagaaccctcggtagtagcggcttgtaacaatggtgtacaaatggct
aaaagttcaggtggttttaccgctgtaatgaagaaaaaggaaatccgtggacaaattgtt
ttaatgaatgtcacagataagagcactgttattgaacaaatcgaaaaaaatgaagcagag
attatttctactgcggaacaatcttatccttctatcgtgaaacgtggtggtggagtgaaa
agagttgtagttcgtgagtttgcggaagatcccaattttttaagtgtggatttaattgta
gatactcaagatgccatgggagcaaatatgctaaatacaatgttagaggctgtggccacg
ctttttcgccaatggttttctgaagaaattttatttagtattttaagtaactatgctact
gatgctttagtaagtgctgaatgttatatttcatttgctagcttaggaaaaggcgatgct
gaaaaaggagaaaagatagctgaaaagattgctgctgcttcaaactttgcacaaattgac
ccttttcgcgcagctacacataacaagggaattatgaatggtatcgatgctgtggttctt
gcaaccggaaatgacacccgaagtgtaaatagcgctgttcatgcgtatgcggcaaaaaat
ggaaaatatcagggattaagccagtgggagattgtagataatcaacttaaaggtagcatt
gaactgccacttgctgtagctactgctggaggtgcaacgaaagttttacctaaagcccaa
gcagcactgcaaatattggatgtaaatgacgcaaaagaattggctgaagttattgcttct
gttggattagcccaaaatttagctgctcttaaagccttggttactgaaggcattcaaaaa
gggcacatggctttacaagcacgcaccttagcgctaagcgttggggcgaaagattccgaa
gtccaaaaagtagctaaccgactgaaaagacaacaaatgaacgaagaaaatgctcgaaaa
attttacaagaactgagaaatagataa

DBGET integrated database retrieval system