KEGG   Thermococcus cleftensis: CL1_0086Help
Entry
CL1_0086          CDS       T02169                                 

Definition
(GenBank) putative glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
thm  Thermococcus cleftensis
Pathway
thm00010  Glycolysis / Gluconeogenesis
thm01100  Metabolic pathways
thm01110  Biosynthesis of secondary metabolites
thm01120  Microbial metabolism in diverse environments
thm01130  Biosynthesis of antibiotics
thm01200  Carbon metabolism
thm01230  Biosynthesis of amino acids
Module
thm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
thm_M00002  Glycolysis, core module involving three-carbon compounds
thm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_0086
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     CL1_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFL94301
UniProt: I3ZRG7
Position
79157..80161
Genome map
AA seq 334 aa AA seqDB search
MKVKVGINGYGTIGKRVAYAVTRQDDMKLIGVTKTKPDFEAYRAAELGIPVYAASEEFLP
RFEKAGFEVAGTLGDLLNEVDVIVDATPGGMGAKNKELYEKAGVKAVFQGGEKASVAEVS
FVAQANYEKALGKDYVRVVSCNTTGLTRTLSAIQEYIDYVYAVMIRRAADPNDTKRGPIN
AITPSVTVPSHHGPDVQTVIPINIETSAFVVPTTLMHVHSIMVELRKPVEAKDVVDIFEN
TTRVLLFEKERGFDSTAQLIEFARDLHREWNNLYEIAVWKESISVRGNRLFYIQAVHQES
DVVPENIDAIRAMFELADKWESIKKTNESLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaaggtgggaatcaacggctatgggacaataggcaagcgcgtcgcctacgcc
gtaacgagacaggacgatatgaagctcatcggtgtgacaaagaccaagcccgacttcgag
gcctaccgcgcggcggagctcggaatcccggtttacgctgccagcgaggagttcctgccg
aggttcgagaaggccggcttcgaggtcgcgggcactctaggcgacctcctcaacgaggtt
gacgtaatcgtagatgccacccccggcggaatgggtgcgaagaacaaggagctctatgaa
aaggccggcgtcaaggcggtcttccagggcggtgagaaggcgagcgttgcggaggtttcc
ttcgtggcccaggccaactacgagaaggccctaggcaaggactacgtccgcgtcgtgtcg
tgcaacacgacgggcctgaccagaaccctcagcgcgattcaggagtacatcgactacgtc
tacgcggtgatgattagaagggccgccgatccgaatgacacgaagaggggtccgataaac
gccataacgccgagcgtcaccgttccgtcccaccacggaccggacgtccagacagtcatt
ccaataaacatcgagacctcggcttttgtagttccgaccacgctcatgcacgtccacagc
ataatggtcgagctgaggaagccggtggaggcgaaggacgtcgttgatatcttcgagaac
accacgcgcgtcctcctcttcgagaaggagaggggctttgacagcacggcccagctcata
gagttcgcccgcgaccttcaccgcgagtggaacaacctgtacgaaatagcggtctggaag
gagagcataagcgtccgcgggaacaggctcttctacattcaggctgtccaccaggagagt
gacgtggttcctgagaacatcgatgcgataagggccatgttcgagctggcagataagtgg
gagagcataaagaagacgaacgagagcctggggattttgaagtga

DBGET integrated database retrieval system