KEGG   Thermococcus cleftensis: CL1_0329Help
Entry
CL1_0329          CDS       T02169                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
thm  Thermococcus cleftensis
Pathway
thm00790  Folate biosynthesis
thm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CL1_0329
Enzymes [BR:thm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CL1_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD DUF561 QRPTase_C DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AFL94540
UniProt: I3ZS56
Position
complement(294422..295240)
Genome map
AA seq 272 aa AA seqDB search
MKFAGVDLSEPRIMGVINVSPESFYKGSVRNDEEKLIETAVKMVKDGASFIDIGAKSTAP
YLETQIPVEEEVKRAVWAVKAIRDHVDVPISIDTTNARVAEEALKAGADIVNDVTGLKGD
PRMAEIAKDHGAPVIVCAHGEVRNLSDPVHTVMDLLKESLVIAEKYGIEEIAIDPAIGFL
RPEWPPWYEWDSRVLANLNVLKTFGRPILVGVSRKSFIGAITGRKDPAERLAGSLSATAI
AVFNGAHIIRTHDVRETLDTVKMAAFIKRFRP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcgggagttgatttgagtgaacccagaataatgggcgtcatcaacgtttca
ccggagagtttctacaaggggagcgtcagaaacgacgaggaaaagctcatcgagaccgcg
gtgaagatggtcaaggacggggcgtccttcatagacatcggtgccaaatcgaccgccccc
taccttgagacccagattcccgttgaggaggaggtaaagagagccgtctgggcggttaaa
gctatccgggaccatgtggacgtgccgataagcatagacaccacgaacgccagggttgca
gaggaagcactcaaagccggggcagacatcgtaaacgacgttaccgggctcaaaggcgac
ccgagaatggcggaaatagccaaggaccacggggctcctgtaatagtctgcgcccacgga
gaggtgaggaatctcagcgaccccgttcacacggtgatggacctcctcaaggaaagcctc
gtcatagctgaaaagtacgggattgaggagatcgccatcgaccccgcgataggattcctc
cgcccggagtggccgccgtggtacgagtgggactccagggttctggccaacctgaacgtc
ctcaagaccttcggaaggccaatcctcgtaggcgtctcgaggaaatcattcatcggggcc
ataaccggcagaaaagaccctgcggagagattagctggcagcctctcggcgacggccata
gccgtcttcaacggcgcccacataatcagaacccacgacgtgagggaaacgctggacact
gtcaagatggcggccttcatcaagaggttcaggccatag

DBGET integrated database retrieval system