KEGG   Thermococcus cleftensis: CL1_0953Help
Entry
CL1_0953          CDS       T02169                                 

Definition
(GenBank) histone acetyltransferase-like protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
thm  Thermococcus cleftensis
Brite
Enzymes [BR:thm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CL1_0953
Transfer RNA biogenesis [BR:thm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CL1_0953
Chromosome and associated proteins [BR:thm03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CL1_0953
   HAT complexes
    Elongator complex
     CL1_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Radical_SAM_C Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: AFL95156
UniProt: I3ZTX2
Position
complement(915849..917621)
Genome map
AA seq 590 aa AA seqDB search
MEERFGKAVEELARLVMSGEIKSREELNRWKIKVSRKYHLSKIPGNSDILKAIPEERREE
FRELLKRKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGREPSALRAVQ
SAYHPYIIMMRRLKQLTDIGHDVDKVEVIIQGGTFPAVDLDYQEWFVKEAFKAMNDFPHF
RDIENLEEKLVRLIVKRDESVLEEDPKFREAWLKTHSKPYYYLEDEQRRNERAKVRMVGL
TIETRPDWAFERHIDRMLKLGTTRVELGVQTIFNFIHERTRRGHGVEEIVKATQLLRDAG
LKINYHIMPGLPGSNFERDLYTFRTIFEDTRFRPDMLKIYPTLVTKDAPLYRWWKEGKYR
PYRTEEAVELLVEAYKLFPKWVRVMRIQRDIPVQLIVDGVKHSNLGQLVFNELIKRGIRP
REIRFREVGHMMEKFGIQPEVEHIKLLREDYGASGGREIFLSFEDVKNDILIGFLRLRIP
SEKAHRREIKCCPSAIVRELHVYGPLVPIGGKPRYEWQHRGYGRELLSEAERIAREEFDV
KKMLVISGVGVREYYRKFGYRKNGPYVAKRLDKSYGDYKKSREFDAHLNT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaggttcggaaaagctgtggaggagctcgcgagactggttatgtcgggtgag
attaagagcagggaggagctcaaccgctggaagatcaaggtctcgcgtaagtatcatctc
tcaaagattccgggcaactccgacatcttgaaggccattccggaggagaggcgcgaggag
ttcagggaactgctcaaaaggaagcctacgaggacgataagcggcgtcgcggtagttgcc
atgatgaccaagccatttccctgcccacacgggcgttgcatctactgcccaggcgggccc
agcgtcggctctccccagagctacacagggagggaaccttcagccttgagggccgttcag
agcgcctaccacccctacataatcatgatgcgtcgcctgaagcagctcaccgacatcggg
cacgacgtggacaaggtcgaggtcataatccagggaggaacctttcccgcggttgatctg
gactatcaggagtggttcgttaaagaggccttcaaggcgatgaacgacttccctcacttc
agggatatagagaaccttgaggagaagctcgtcaggttgatagtgaaaagagacgagtcc
gtcctggaggaggaccccaagttcagggaggcgtggcttaagacacactcaaagccctac
tactaccttgaggacgagcagaggaggaacgagagggctaaggtcagaatggtcgggctt
acgatagagacgcgcccggactgggcctttgagaggcacatagacaggatgctgaagctc
ggaacaacgagggttgagctcggcgttcaaacgattttcaacttcattcatgagagaacc
aggcgcggtcacggcgtcgaggagatagttaaggccactcaacttctccgcgatgcgggc
cttaaaatcaactaccacataatgcccggccttcccgggagcaacttcgagagggacctc
tacactttcaggacgatcttcgaggatacccggttccgccctgacatgctgaaaatttac
cccactctcgtgaccaaagacgctcccctctaccgctggtggaaggagggtaaatatcgt
ccctatcgcactgaggaggccgttgagctcctcgtcgaggcctacaagctcttccccaag
tgggttcgcgtgatgagaatccaacgcgacattcccgtccagctaatcgtcgacggcgtc
aagcactccaatctgggccagctggtcttcaacgagctgataaagcgcggtataaggccg
agggaaatccgctttagagaagtcggccacatgatggagaagtttggaatccagcccgag
gttgagcacataaagctcctccgcgaggactacggggcatctggcggaagggaaatcttc
ctgagcttcgaggacgtcaagaacgacatactgatagggttcttgaggctgaggattccg
agcgagaaggcccacaggagagagataaaatgctgtccttccgctatagtcagggagctc
cacgtttacggccccctcgtgccgattggtggtaaacctaggtacgagtggcagcaccgc
ggttacggaagggagcttttgagcgaggccgagaggatagcgagggaggagtttgacgtc
aagaagatgctagttataagcggcgtcggcgtgagggagtactacagaaagttcggctac
cggaagaacgggccctacgtcgccaagaggctcgacaaaagctatggggattacaaaaag
agcagggagttcgacgcgcacctgaacacctag

DBGET integrated database retrieval system