KEGG   Thermococcus cleftensis: CL1_1245Help
Entry
CL1_1245          CDS       T02169                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
thm  Thermococcus cleftensis
Pathway
thm00010  Glycolysis / Gluconeogenesis
thm00020  Citrate cycle (TCA cycle)
thm00620  Pyruvate metabolism
thm00640  Propanoate metabolism
thm00650  Butanoate metabolism
thm00680  Methane metabolism
thm00720  Carbon fixation pathways in prokaryotes
thm01100  Metabolic pathways
thm01120  Microbial metabolism in diverse environments
thm01130  Biosynthesis of antibiotics
thm01200  Carbon metabolism
Module
thm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1245
   00020 Citrate cycle (TCA cycle)
    CL1_1245
   00620 Pyruvate metabolism
    CL1_1245
   00640 Propanoate metabolism
    CL1_1245
   00650 Butanoate metabolism
    CL1_1245
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CL1_1245
   00680 Methane metabolism
    CL1_1245
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CL1_1245
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CL1_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_8 Fer4_4 Fer4_17 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AFL95444
UniProt: I3ZUR0
Position
complement(1203924..1204241)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIATIPGSSVINKTGSWRVFMPEFNRDKCVRCYLCY
IYCPEPAIYLDEENYPVFDFDYCKGCGICANECPTDAIIMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagtccgtttaaggccgacatcgagagggttcagaaggagtatagcgaaaag
atgaccccgggagcgatagccaccattccggggagcagcgtgataaacaagaccggttcc
tggagagtttttatgcccgagttcaacagggacaagtgcgtccgctgctacctctgctac
atctactgcccggagccggccatctacctcgacgaggagaactatccggtctttgacttc
gactactgcaagggctgtgggatatgtgccaacgagtgcccgaccgatgccataataatg
gttagggagaccaagtga

DBGET integrated database retrieval system