KEGG   Thermosynechococcus sp. NK55: NK55_00390Help
Entry
NK55_00390        CDS       T02977                                 

Definition
(GenBank) inorganic phosphate transporter (PiT) family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
thn  Thermosynechococcus sp. NK55
Brite
KEGG Orthology (KO) [BR:thn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NK55_00390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHB87467
UniProt: V5V3N7
Position
complement(83588..84577)
Genome map
AA seq 329 aa AA seqDB search
MAIDFKGGLMAIALLFDVTNGFHDAANAIATVVATRALSLRSALLLAAVANFGGAFLSTR
VALTIEAGILNSTALGSHWFGVISAALLGAMAWNLLTWYWGLPSSSSHALIGGLVGAALF
QVSPQIIYWQGIIGSVVIPMVVSPLVAIAVGLSFMALVEKWLQWQDIPPEHWQRLQILSG
MLMAVAHGANDAQKTMGVMTLALVSWGELSPDAGVPVWVIAACALAIALGTYGGGERIIH
TTGEKITSLDPVSGCLANLSAALTVGAASLVGFPVSTTQVVVGAITGAGYRHQGEVNWHV
WGQIFMAWVLTFPGAALLAMAISFCLAQL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggccattgatttcaagggggggctgatggcgatcgccctcctttttgatgtcaccaat
ggtttccatgatgccgccaatgccattgcaacggtggtggccacccgtgccctttccctg
cgctcggcgctcctccttgctgctgtggctaattttggtggtgctttcttgagtacgcgg
gtggcgctaaccattgaagcaggtattctcaacagcactgccttgggtagccattggttt
ggcgtgattagtgctgcactccttggtgcgatggcctggaatttgctcacttggtattgg
ggcttgcccagtagttcttcccacgcccttattggtggcttggtgggggcagccctcttt
caagtgtcaccccagatcatctattggcagggaattattgggtcggtagtcattcccatg
gtcgtgtctcccttggtggcgatcgcggtcggcctgagtttcatggcgcttgtcgagaaa
tggctgcaatggcaagacattcccccagaacactggcaacggttacagattctctctgga
atgttgatggcagtggcccacggtgccaatgatgcccagaaaacaatgggggtcatgacc
cttgccctggtgagttggggagaactgtctccggatgccggtgtccccgtctgggtgatt
gctgcctgtgccttagcgatcgcgctcgggacctatggcggcggcgagcgcattatccac
accacaggggagaaaattacatcccttgaccctgtgagtggctgcttagctaacctgagt
gccgccttaacagtcggagccgctagtctagtgggctttcccgtcagtaccacccaagtc
gtggtgggggcaattacgggtgccgggtatcgccatcaaggggaagtgaactggcacgtg
tggggccaaattttcatggcatgggtgctgacgtttcccggtgcagccctgctggcgatg
gcaatctctttttgtctagcgcaactgtaa

DBGET integrated database retrieval system