KEGG   Thermosynechococcus sp. NK55: NK55_08260Help
Entry
NK55_08260        CDS       T02977                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase iron containing GldA
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00561  Glycerolipid metabolism
thn00640  Propanoate metabolism
thn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NK55_08260 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    NK55_08260 (gldA)
Enzymes [BR:thn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     NK55_08260 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC
Motif
Other DBs
NCBI-ProteinID: AHB88928
UniProt: V5V698
Position
complement(1725890..1727008)
Genome map
AA seq 372 aa AA seqDB search
MTAAFSSLCIAPTHIYRGWSIFSQAGEAIAQLGHHPLLVVSPQRYQQLEQEWQAIAHSHD
LTFTVGTFHGECSESTLAQLRQEAQGSDLIIGIGGGKALDTAKLLGHQLHLPVVTIPTSA
ATCAAWTALSNVYTEAGAFAYDVALHRCPDLLLLDYALIQTAPKRTLLAGIGDALAKWYE
ASVSSGHRQETLIVAAVQQARVLRDILLQRSAEALNNLGSPAWENLVDASVLMAGMIGGL
GGAQCRTVAAHAIHNGLTQLPQSQGTLHGEKVAYGILVQLRLEEIVQGSQLATSARHQLC
QFYEQVGLPLSLEDLGFREASLAQLQHAATVACAPHSDIHYLPFPVTPDLVLEAMVSTVV
GYSAKVLDGSAR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctgctttttcatccctttgcatcgcgcctacccacatctatcgcggttggtca
attttctcccaagcaggggaagccattgcgcaattggggcatcatccccttttagtggtt
tcaccgcagcggtatcagcagcttgagcaggagtggcaggcgatcgcccactcccatgat
cttactttcaccgtaggaacattccatggtgagtgcagcgagtctacccttgcccaactc
cgccaagaggcccaaggcagcgatctgatcatcggcattggcggtggcaaagcgctggat
accgctaagctcttggggcaccaacttcacttgcccgtggtgaccatccccacgtcggca
gccacctgcgccgcttggacagccctttccaatgtttatacagaggccggtgcttttgcc
tatgatgtggcactccaccgttgcccagatctgctactgttggactacgccctgattcaa
acagctccgaagcgaaccctgcttgccggcattggtgatgcccttgccaagtggtatgag
gcttcggtcagtagtggccaccgccaagaaaccctgattgtcgctgctgtacagcaagct
cgtgtattgcgcgatattctcctacagcggtctgccgaagccttgaacaatctgggcagt
cccgcttgggaaaatctggttgatgccagtgtcctgatggcaggaatgatcggtggattg
gggggtgcccaatgccgcacagtagcagcccatgcgatccacaacggtttgacccaactg
ccccaaagtcagggcaccctccacggtgaaaaagtggcctacggtattcttgtccaacta
cgcttggaagagattgtccaaggcagtcaactggccacaagtgctcgccatcaactttgc
cagttttatgaacaggtgggtctgcccctgagtttagaggatttgggcttccgagaggcc
agcttggcgcaactccagcacgccgctacggttgcctgtgcgccccattccgatattcac
tatctgccgtttcccgtgacgcctgatctagtgctagaagcaatggtgtccaccgtggtc
ggctacagcgccaaagtcttggatgggagtgcccgctag

DBGET integrated database retrieval system