KEGG   Thermosynechococcus sp. NK55: NK55_09645Help
Entry
NK55_09645        CDS       T02977                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22 RplV
  KO
K02890  large subunit ribosomal protein L22
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:thn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NK55_09645 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:thn03011]
    NK55_09645 (rplV)
Ribosome [BR:thn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NK55_09645 (rplV)
  Bacteria
    NK55_09645 (rplV)
  Archaea
    NK55_09645 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHB89183
UniProt: V5V703
Position
2023117..2023485
Genome map
AA seq 122 aa AA seqDB search
MVSTSSPTARACAKYVRMSPHKVRRVLDQLRGRTYRDALIMLRFMPYRACEPITKVLRSA
AANATHNLGLDPATLVISQAYADQGPCLKRFRPRAQGRAYQIRKPTCHITIAVAPQNTAD
ES
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtttctacctcttctcctactgcccgtgcctgcgccaagtatgtccgcatgtcaccc
cacaaagtgcggcgggtactagatcaactgcggggtcgcacctaccgcgatgccctcatt
atgctgcgctttatgccctatcgtgcctgtgagccgattacgaaggtcctgcgatcggcg
gcagccaatgccacccacaatttaggcttagatccggccaccttggtgattagtcaggcc
tatgccgatcaagggccttgcctgaagcggttccgcccccgtgcccaaggtcgcgcttac
caaattcgcaaacccacctgccacatcacgattgctgtggcgccccaaaacactgctgac
gaatcgtag

DBGET integrated database retrieval system