KEGG   Thermosynechococcus sp. NK55: NK55_11710Help
Entry
NK55_11710        CDS       T02977                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase Zwf
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00030  Pentose phosphate pathway
thn00480  Glutathione metabolism
thn01100  Metabolic pathways
thn01110  Biosynthesis of secondary metabolites
thn01120  Microbial metabolism in diverse environments
thn01130  Biosynthesis of antibiotics
thn01200  Carbon metabolism
Module
thn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
thn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:thn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NK55_11710 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NK55_11710 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thn04147]
    NK55_11710 (zwf)
Enzymes [BR:thn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     NK55_11710 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     NK55_11710 (zwf)
Exosome [BR:thn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NK55_11710 (zwf)
  Exosomal proteins of colorectal cancer cells
   NK55_11710 (zwf)
  Exosomal proteins of bladder cancer cells
   NK55_11710 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Pertussis_S2S3
Motif
Other DBs
NCBI-ProteinID: AHB89575
UniProt: V5V871
Position
complement(2454976..2456505)
Genome map
AA seq 509 aa AA seqDB search
MVTLFENPLRVGLRQERTPEPLILVIFGASGDLTQRKLIPSIYQLRLERRLPPELTIVGV
ARRNWSDDYFREHLRQGVEEFGGGIQAEPLWQEFAQGLFYCSGNIDDPAAYAQLKTLLAE
LDEKRQTRGNRVFYLAVSPNFFVEAIQQLGTAGLLSDPQKHRLVIEKPFGRDLTSAQALN
EVVQSVCKEEQVYRIDHYLGKETVQNLMVFRFANAIFEPLWNRQYVDHVQITVAETVGVE
DRAGYYETSGALRDMVQNHILQLLALTAMEPPNALDADSLRSEKVKVLQATRLADLDNLD
ACAVRGQYRAGWMKGKPVVGYCEEPGVSPTSTTPTYAALKLMIDNWRWQGVPFYVRTGKR
LAKKVTEISIQFCEVPLLIFQSAARQTNPNVLTMRIQPNEGIALRFEAKMPGADLRTRTV
EMDFSYGSSFGMATADAYARLLLDCMLGDQTLFTRADEVEAAWRVVMPVLTAWDAPTDPE
AIPTYDAGTWGPDAAEVMINADGRRWRRL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccttgtttgaaaatcccctgcgggttggactacgccaagaacgaaccccagag
ccactgattttggtgatttttggtgccagtggcgatcttactcagcgcaagctgattcct
tcgatttatcaactgagactcgaacgccgtctgccccccgaacttaccattgttggcgtg
gcacgtcgcaactggagtgatgactattttcgcgagcacctccgccaaggggtcgaggag
tttggtggcggcattcaggcggagcccctgtggcaggaatttgcccaaggtctgttttat
tgctctggcaatatcgatgatcccgccgcctacgcccagctgaaaacattgctagctgag
ctagatgaaaaacgccaaactcgcggcaatcgcgtcttttaccttgcggtctcgccgaac
tttttcgttgaagccattcagcaactggggacagcggggctattgagtgatccccaaaag
catcgtctcgtgattgaaaagccttttggccgtgatctcacctctgcccaagccctcaat
gaggtggtgcagtcggtgtgcaaggaggagcaggtttaccgcattgaccactaccttggc
aaagagacggtgcaaaacctgatggtgtttcgctttgccaatgccatttttgaacccctc
tggaaccgccagtacgtggatcatgtgcagattacggttgccgaaaccgtcggggttgaa
gaccgggccggctactatgaaacttcgggtgccctgcgggacatggtgcaaaaccacatt
ctccagttgctggctctgacggctatggaaccccccaatgccctcgatgccgatagtctg
cgcagcgaaaaggtgaaggtcctccaagccacccgtttagcggatcttgataatctcgat
gcctgtgctgtccgcggccaataccgagccggctggatgaagggcaaacctgttgtgggc
tattgtgaggagccgggcgtgagtcccacctccaccactcccacctatgcggccctaaaa
ctcatgattgataactggcgatggcagggggtgcccttttatgtgcgcacgggtaaacgc
ttggcaaaaaaggtcacagaaatctcaattcagttttgtgaggtgcctttactgattttc
cagtcggccgcccgccaaaccaatcccaatgttctaacgatgcgcattcaacccaatgaa
gggattgctctgcgctttgaggcaaaaatgcccggtgcagatctgcgcacacgcacggtg
gaaatggactttagctacggctcctcctttgggatggcgaccgcggatgcttatgcgcgg
ttattactggactgcatgttaggggaccaaaccctgtttacgcgggcagatgaggtggag
gcggcttggcgcgtggtgatgccggttttaacggcttgggatgcccccactgatccagag
gccatacccacctatgacgcggggacttgggggccggatgcagcagaggtgatgattaat
gccgatggccggcgctggcggcgactgtaa

DBGET integrated database retrieval system