KEGG   Candidatus Thioglobus autotrophicus: SP60_01750Help
Entry
SP60_01750        CDS       T04079                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
tho00620  Pyruvate metabolism
tho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SP60_01750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tho02000]
    SP60_01750
Enzymes [BR:tho01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SP60_01750
Transporters [BR:tho02000]
 Other transporters
  Primary active transporters [TC:3]
   SP60_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ALE52073
UniProt: A0A0M5LHC8
Position
complement(324070..325881)
Genome map
AA seq 603 aa AA seqDB search
MTKKPNKAETKKVEITELVFRDAHQSLFATRMRIDDMLPIADKLDKIGYWSIESWGGATF
DSCIRYLGEDPWDRIREIKAVMPNTPQQMLLRGQNLLGYRHYSDDVVRKFVDRCAENGVG
VFRIFDAMNDVRNLKTAVDQAVKLDQHAQGTISYTVSPVHNAQTWLDMAKQIEDMGAHSL
CIKDMAGLLQPYVAYDLVKQLKEEIDIPIQLHAHATTGLSTATIIKSVEAGIDRVDTAIG
SMSMTYGHSATNSVVSILENSPRKTGLDLEKLEEIDAYFRPIRCKYAQFEGSLRGVDSRI
LLSQVPGGMLTNMENQLREQNAADKMDEVLAEIPRVRKDLGYIPLVTPTSQIVGTQSVLN
VLTGERYKTITKESAGVLKGEYGATPAPVDQALQVKILDGAEPITCRPADNIAPEMHILE
QEFDKVVAEKGIQLAANKIDDLMTYALFPQVGISFLENRNNPDFFEPVPQETNNCVAPDS
EEGTYTVSFKGNSYTVDVSAGGDVTSMKASSDATTAAAPAAEKEIVSEVPATGGEAIGAP
LSGNIWKVMVSLNQKINEGDVLVILEAMKMETEIKAARSGVVTEINIKEGDAVTVGQALL
SLA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaaccaaataaagctgagactaagaaagtagagattacagaattagtcttt
agagatgcacatcagtctttatttgcaacacgcatgcgcattgacgacatgttgccaatt
gccgacaagctcgacaaaattggctactggtcaatcgagtcatggggcggtgctacattt
gattcttgtattcgttatttgggtgaagatccttgggatcgtattcgtgaaattaaagcg
gttatgccaaatacgccacagcagatgttgttacgtggtcaaaatcttttaggttatcgc
cactatagtgatgatgtcgtacgtaaatttgttgatcgctgtgcagaaaatggcgtcggt
gtctttagaatttttgatgcgatgaatgatgtcagaaatctaaaaacagccgttgatcaa
gcagttaagttagaccagcatgctcaaggaactatttcttatacggttagtcctgtgcac
aatgcgcaaacttggctagatatggccaagcaaattgaagatatgggtgcacattcttta
tgtattaaagatatggccggactattgcagccctatgttgcctatgatttggttaaacaa
ctcaaagaagagattgatattccaattcagttgcatgcacacgcgacaacaggactttca
acagcaaccattattaaatcagttgaagcgggcatcgaccgtgttgatacggctattggc
tcaatgagtatgacttatggtcactctgcaacaaactctgtggtttctattttagaaaat
agccctagaaaaactggacttgacctagaaaaactagaagagattgatgcctactttaga
cctattcgctgcaaatacgcgcaatttgaaggctctttaagaggtgttgattcgcgtatc
ttgctatctcaggtgcctggtggcatgctaaccaacatggaaaaccaactgcgcgagcaa
aatgcagcagataagatggatgaagtgttggcagaaatcccacgcgtacgcaaagattta
ggctatattcctttagtaacgccaacttctcaaattgttggcacacagtctgtactaaac
gtattgacgggtgagcgttacaaaactattacgaaagagtcggctggtgtgctaaaaggt
gaatatggtgcaacacctgcacctgtggaccaagcattgcaagtaaaaatactcgatgga
gctgagccaattacatgtcgtcctgctgataatattgcaccagagatgcatattttagag
caagagtttgataaagtagttgctgagaaaggcattcagctagctgctaacaaaattgac
gatttaatgacctatgccttatttcctcaagtgggtatttcctttttagagaatcgcaac
aatcctgatttctttgagccggtaccacaagaaactaataattgtgttgcgcctgatagt
gaagagggcacttacacggtttcttttaagggtaattcttatacagttgatgtctctgca
ggcggtgacgttacttcaatgaaagcatcttctgatgcaacaacagcggctgcaccagcg
gctgagaaagagattgttagtgaagtaccagcaacaggcggagaagcaattggcgcacca
ctttcgggtaatatttggaaagtgatggtttcgcttaatcaaaaaattaatgaaggtgat
gtgctggtgattcttgaagcgatgaaaatggagacagaaatcaaagctgctagaagtggt
gtagtcacagaaatcaatattaaagaaggtgacgcagtaactgttggtcaagccttgtta
tctttagcctaa

DBGET integrated database retrieval system