KEGG   Candidatus Thioglobus autotrophicus: SP60_02220Help
Entry
SP60_02220        CDS       T04079                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
tho00860  Porphyrin and chlorophyll metabolism
tho01100  Metabolic pathways
tho01110  Biosynthesis of secondary metabolites
tho01120  Microbial metabolism in diverse environments
Module
tho_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SP60_02220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tho01007]
    SP60_02220
Enzymes [BR:tho01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SP60_02220
Amino acid related enzymes [BR:tho01007]
 Aminotransferase (transaminase)
  Class III
   SP60_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 CTP_transf_3 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ALE52155
UniProt: A0A0M3TU18
Position
complement(416446..418476)
Genome map
AA seq 676 aa AA seqDB search
MKVVAIIQARMGSARLPNKVMMRINHIPMIELLIDRLSNSKHIDQIVLATSNNKNNIPLI
NHVESLGYKVFSGEENDVLDRYFQAAKTFKANAIIRITGDCPLIDSFLVDEVIEGFIDSN
VDYASNREPPTYPDGLDVEVISIKALEEAHKKGKEDFQREHVTPYIINSDTFKKFYLKNS
KDFSAERWTVDEPEDFTVVQNIFNYFHPEINFSWKKIIELKENKPKLFTVNEHLIRNEGA
VMSTGEKLWSRAKRIIPGGNMLLSKRSEMFLPDHWPAYFSKAKGCKVWDLDGREYTDMSI
MGIGTNILGYGNDEVDAAVINVVKKGNMSTFNCPEEVYLAEKLIELHPWANMVRLARTGG
EANAIAIRIARAASGKDKVAICGYHGWHDWYLSANLEDDDNLTGHLLPGLNPKGVPKDLK
GSVVPFNYNRIDELETIIQNHDIGVIKMEVSRNDEPQDDFLVKVRKIASENNIILIFDEC
TSGFRQSNGGLHKLYGIEPDMAVFGKALGNGYAITAVIGRKEVMDVAQSTFISSTFWTER
IGPTAALKTLEVMDKTKSWELITNTGKDIGNQWKNLGEKYQLPIKVNGLPSMIGFGIQSD
DWLKYKTYITQEMLKNNILASNVIYVCTEHGIQEIDNYFQILDPIFKVIADCENGDLSVD
SLLDGPVCHGGFTRLN
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtagcaattatccaagcaagaatgggatctgctcgtttgcctaataaggta
atgatgagaatcaatcatatcccaatgattgagttgttgattgataggctgtctaattct
aagcacattgatcaaatagtactcgccacttcaaataataaaaataatatcccattaatt
aatcatgttgaaagtttgggttataaggtattttctggagaggaaaatgatgtgttggat
agatattttcaagcagcaaaaacatttaaagctaatgctattatcagaataactggggat
tgtccattgatagatagttttcttgttgatgaagtgatagagggatttattgattctaat
gtagattatgctagtaatcgtgagccacctacttatccagatgggttagatgttgaagtt
atttcaattaaggcgctagaagaagctcataaaaagggaaaagaagactttcagagagag
catgtaacgccttatattatcaattctgatacttttaagaaattttatctaaaaaattct
aaggatttttctgcagaaagatggacagttgatgagcctgaagactttactgtagtgcaa
aatatttttaattattttcacccagaaataaatttttcatggaaaaaaataatagagtta
aaagaaaataaaccaaaattatttactgtaaatgagcatttaattcgcaacgagggggcg
gttatgagtactggggaaaaattatggtcaagagctaagcgtattattccaggtgggaat
atgctgctatccaagagaagtgaaatgtttcttccagatcattggccagcgtattttagc
aaggctaaaggttgcaaagtatgggatttggatgggcgtgaatataccgatatgtcaata
atgggaattggcacaaacatcttgggttatggtaatgatgaagtggatgctgcagttata
aatgttgttaaaaaaggaaacatgtctacatttaactgtccagaagaggtatatcttgct
gaaaaattgattgagcttcacccttgggcaaatatggtacgcttggcaagaacaggtggt
gaggcaaatgcaatagcaattagaatagcaagggctgcatctggtaaagataaagtagct
atttgtggttaccatggttggcatgattggtatttatccgcaaatctagaagacgatgat
aatcttacagggcacctcttaccaggtttaaatcctaaaggtgttcctaaagaccttaaa
ggcagtgtggttccattcaactataatcgcatagatgagctagaaactattatacaaaat
catgatattggcgttataaaaatggaagtctctcgcaatgacgaacctcaagatgatttt
ttggttaaggtaagaaagatagcaagtgaaaataatattattttgatttttgatgagtgc
acttctggcttcagacaaagcaatggcgggcttcataaattatatggcattgagccagat
atggctgtttttgggaaggctttgggtaatgggtatgctattactgctgtaatcggaaga
aaagaagtaatggatgttgctcaaagtacttttattagctccactttttggactgaaaga
attgggcctacagccgcattaaagacgttagaggttatggataaaactaagtcatgggaa
ttgataactaatacgggcaaagatattggcaatcaatggaaaaacttaggtgaaaagtat
caattacctattaaggttaatggtttaccgtctatgattggatttggtattcaatctgat
gattggttaaagtataaaacttacataactcaagagatgctaaaaaacaatattcttgct
tcaaatgtaatctatgtttgtacagagcatgggatacaagagatagataattatttccaa
atattagacccgatttttaaagtgatagctgattgtgaaaatggtgacttatcggtagat
tctttattagatggacctgtttgtcacggtgggtttacaaggttgaattga

DBGET integrated database retrieval system