KEGG   Candidatus Thioglobus autotrophicus: SP60_02395Help
Entry
SP60_02395        CDS       T04079                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
tho00540  Lipopolysaccharide biosynthesis
tho01100  Metabolic pathways
Module
tho_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:tho00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SP60_02395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tho01005]
    SP60_02395
Enzymes [BR:tho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     SP60_02395
Lipopolysaccharide biosynthesis proteins [BR:tho01005]
 Unusual sugar
  SP60_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ALE52185
UniProt: A0A0M3TU24
Position
453919..454923
Genome map
AA seq 334 aa AA seqDB search
MTYSNTDFNNKTILITGGAGFIGSNLAFYFQDNYPDSRVVVFDCFRSEVTFANGNLQSFG
HYKNLIDFTGDVVCGNINSKPDLALLDDYKFDYMFHQAAISDTRVYDQEIVMQTNVNSFY
DLLNKAKNDDAVMVYASSAATYGSLPSPQTVGIENPENPYGFSKYMMDQIAYRYSRENPD
MTIVGLKFFNVYGPREYYKAKTSSMVIQLGHQILDGKAPKLFEGSDQILRDFINIEDVIQ
ANIKACNPKQNGTYNVGTSNPRSFQDIADILQHELGTDLGTDYIPNPYDGYQMHTQADIS
TTQTNLGFEPVVSLEVGIKAYIPDIKRLHGTDIS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacatatagcaatacagatttcaataataaaaccattttaattaccggcggagcaggt
tttattggtagcaatttagctttttatttccaagataattatcctgattcacgtgttgtg
gtgtttgattgctttagaagtgaagtgacctttgcaaatggtaacttacaaagttttggt
cattataaaaatctcatcgattttactggcgatgtagtctgtggcaatattaatagtaag
cctgatttagcgctactggatgattacaaatttgattacatgttccatcaggcagcaatt
tcagacacgcgtgtgtatgatcaagaaattgtcatgcaaaccaatgttaactcattttat
gacttgcttaataaagcaaaaaatgatgatgctgtcatggtgtatgcaagctctgctgcc
acttatggtagcctcccatcgccgcaaactgttggcatagagaatcctgaaaacccttat
ggatttagtaaatatatgatggatcaaattgcctatcgctatagtcgtgaaaatcctgat
atgactattgttggcttaaagtttttcaatgtttatggaccacgcgaatattacaaggca
aaaacctcttcaatggtgattcaacttggacatcaaatcttagatggaaaagcgccaaaa
ttattcgaaggctcagatcaaatattacgagattttattaatattgaagacgtcatacaa
gctaatatcaaagcctgcaaccctaagcaaaatggcacttataacgtcggcaccagcaac
cctaggagttttcaagatattgctgatatcttacaacacgaactgggtacagatttgggt
acagactacatacccaacccatatgacggttatcaaatgcacacgcaagctgacattagc
acgacacaaaccaacttaggttttgaaccagtagtttctctagaggtaggtattaaagct
tatattcctgatattaagcgtttgcatggaacggatatttcataa

DBGET integrated database retrieval system