KEGG   Thermosipho sp. 1063: BG95_00865Help
Entry
BG95_00865        CDS       T04625                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
thp  Thermosipho sp. 1063
Pathway
thp00620  Pyruvate metabolism
thp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG95_00865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thp02000]
    BG95_00865
Enzymes [BR:thp01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BG95_00865
Transporters [BR:thp02000]
 Other transporters
  Primary active transporters [TC:3]
   BG95_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: APT71537
UniProt: A0A1L7BD82
Position
complement(173123..174499)
Genome map
AA seq 458 aa AA seqDB search
MFVDTTLRDGHQSLIATRMRTIDMIPALESMDSLGFNAMEVWGGATFDVCVRFLKEDPWE
RIRTIKSKLKNTKTQMLLRGQNLVGYRHYADDVVELFVKKAIENGVDKIRIFDALNDIRN
LEKSIEVALTNGAHVQGAISYTISPVHTTEYYISFAQKLVERGVHSLCIKDMAGLLTPKK
SFELVKTLKERFNVPVELHTHCTSGLGDLNYISAVEAGVDILDTALSPFASGTAQPPFES
MYYAVREYRNIPEINWESIAYLVEYFTKIREKYKEYDVMMKSIDYRILVSQVPGGMYSNL
VKQLSEQKMLHKLQDVLDEIPRVRKDLGYPPLVTPTSQIVGVQAVLNVLSGERYKKVTNE
VKNYVKGMYGRPPAPIDKELMEKILGDEKPIDCRPADLLEPELEKLKREIGILADTDEYL
LIYAILGEVGRKYLREKYEEKIRVDFALVDEYEGGYPI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtagataccacactaagggatggtcatcagtctttaattgcaactagaatgaga
acaattgatatgattcctgcattggaatccatggattctttgggatttaatgctatggaa
gtttggggtggcgcaacttttgatgtatgtgtaagatttttaaaagaggatccatgggag
cgcatcagaacaattaagtctaaattaaaaaacacaaaaactcagatgttgcttagaggg
cagaatttagttgggtataggcattatgccgatgatgtagttgaattgtttgtaaaaaaa
gcgattgaaaatggtgtggacaaaataagaattttcgatgcgttgaatgatataagaaat
cttgaaaaaagtatagaggtggctttgacaaacggggcccatgtgcaaggagctatttcc
tacacgataagtcctgttcacacaactgaatattatatttcctttgcacagaaattagtt
gaacgtggtgtgcattctttgtgtataaaagatatggcggggttgttaactccaaaaaaa
agttttgaattggtaaaaacattaaaagaaagatttaatgtaccagttgaattacacaca
cattgtacatctggattgggagatttaaattacatttcagcagttgaagctggtgttgat
attttggataccgctttatcaccttttgcatctggaaccgctcaaccaccatttgaatcg
atgtattatgcagttagagaatatagaaatattcctgagataaactgggaaagtatagct
tatcttgtggaatattttacaaagatacgagaaaaatacaaagaatatgatgtaatgatg
aaaagtatagactataggatcttagtttcacaagttccaggtggaatgtactcaaatttg
gtaaaacaactttcagaacaaaagatgttacataagcttcaagatgttttagacgaaata
cccagagtgaggaaggatttaggatatcctccacttgttactccaactagtcaaattgtt
ggagtacaggcagtcctaaatgttttatctggcgaaaggtataaaaaggttacaaatgaa
gtgaagaattatgtgaaaggaatgtatggaagacctcctgccccaattgataaagaatta
atggaaaaaattttaggtgatgaaaaacctatagattgtagaccggcagatttacttgaa
cctgagttagaaaaattgaagagagaaatagggatattagctgatacagacgaatatttg
ttgatttatgcaattttaggtgaagttggaagaaaatatcttagggaaaaatatgaggaa
aaaatacgcgttgattttgcgttggtggatgaatatgaaggaggttatcccatttga

DBGET integrated database retrieval system