KEGG   Thermosipho sp. 1063: BG95_01270Help
Entry
BG95_01270        CDS       T04625                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
thp  Thermosipho sp. 1063
Pathway
thp00260  Glycine, serine and threonine metabolism
thp01100  Metabolic pathways
thp01110  Biosynthesis of secondary metabolites
thp01120  Microbial metabolism in diverse environments
thp01130  Biosynthesis of antibiotics
thp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BG95_01270
Enzymes [BR:thp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BG95_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Pyridoxal_deC Met_gamma_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: APT71615
UniProt: A0A1L7BDE1
Position
complement(257959..258972)
Genome map
AA seq 337 aa AA seqDB search
MYIDLRSDTVTKPTEEMRKAMAYAEVGDDVYMDDPTVNKLEKLCADILGKEASLFVPSGT
FANQLALFTHCQRGDEVIIGDNYHIVQHEAGAAAVIAGVQLRTVETKKGAMIPEVLESKI
RKVEDIHYPRTGLICLENAHSNGNVIPLDNFKKIREIAGNIPIHLDGARLFNASTFLKVE
PKEIAKYADSINICLSKGLCAPVGSLLVGNKEFIERARKKRKIMGGGMRQVGILAAAGIV
ALEKMRFRLEEDHENARYLAKRLSNFAFIEIVEKVEINMVFFKIDKNFSTNEFIEYLLKN
NIKINPPEDGVFRFVTHYWIKREDIDYVVETMAKFFN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtacatagatttaagaagtgatacagtaacaaaacctacagaagagatgagaaaggca
atggcatacgcagaagttggagatgatgtatatatggatgatccaacggtaaacaagctt
gaaaagttatgtgcagatatattgggaaaagaagcttccttgtttgttccaagtggtact
tttgcaaatcaacttgctttgtttacccattgtcaaagaggagatgaggttattatcggt
gacaactatcatatagtccagcatgaagcaggtgctgctgctgtaattgcaggtgtgcag
ctaagaacagttgagacaaaaaaaggtgcgatgattcctgaagttttagagagtaagata
aggaaagttgaagatatacactatcccagaacaggattgatttgtcttgaaaatgcccat
tcaaatgggaatgtaatacctttggataactttaaaaaaataagagaaatagcaggaaat
attcctattcatctagatggagcaagattgtttaatgcgtcaacctttctaaaggtggaa
ccaaaagaaattgcaaaatatgctgattctataaatatctgtctttcaaaagggttatgt
gcacctgttggttcacttttggttggaaacaaggagtttattgaaagggcgagaaaaaag
cgtaaaataatgggcggtggtatgcggcaagtgggaatattagctgcggcgggcattgtt
gcattagaaaaaatgcgttttagattggaagaagatcatgaaaatgcaagatatttggca
aaaaggttgagtaattttgcctttatagaaattgtcgaaaaggttgaaataaacatggta
tttttcaagatcgataagaatttttccacaaatgaatttattgagtatcttttaaaaaac
aacataaaaataaatccgccagaggacggagtgtttaggtttgttacacattattggata
aaaagagaggatattgattatgttgtagaaaccatggcaaagtttttcaattaa

DBGET integrated database retrieval system