KEGG   Thermosipho sp. 1063: BG95_03835Help
Entry
BG95_03835        CDS       T04625                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
thp  Thermosipho sp. 1063
Pathway
thp00670  One carbon pool by folate
thp00790  Folate biosynthesis
thp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BG95_03835
   00670 One carbon pool by folate
    BG95_03835
Enzymes [BR:thp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BG95_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 RibD_C
Motif
Other DBs
NCBI-ProteinID: APT72050
UniProt: A0A1L7BEM8
Position
765340..765843
Genome map
AA seq 167 aa AA seqDB search
MHLSMIVVTDIFGGFSTKDYDPINWGSKEDKKHFRKITTEIGTVIMGRKTFESIGHPLKD
RLNIILTTQKKENKENIIFTKGSPEKIIKFLENQKIHSAAIIGGKKVFEDFFPFVDKLYI
TIEPIVLENAQKLNFPKTSFKLVATNVLNSKGTIVLEYKKLSQKDFL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcatctttcaatgatagttgtaacagacatttttggtggattttccacaaaagactat
gatccaataaattggggttcaaaagaagataaaaaacattttcgaaagattacaacagaa
attggaacagttataatgggaagaaaaacatttgaaagtataggacatcctctcaaagat
agattaaatataatacttaccactcagaaaaaagaaaacaaagaaaatataatatttact
aaaggctcaccagaaaaaattataaaatttttggaaaatcaaaaaatccattctgcagcg
attataggcggaaaaaaggtgtttgaagatttttttccgtttgtagataaactatatata
acaatcgaacctattgtacttgagaatgcacaaaaattgaattttccaaaaacatcattt
aaattagtcgctaccaacgtattaaattcaaaaggtacaatagtacttgaatacaaaaaa
ctatcccaaaaagactttctttag

DBGET integrated database retrieval system