KEGG   Thermosipho sp. 1063: BG95_04825Help
Entry
BG95_04825        CDS       T04625                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
thp  Thermosipho sp. 1063
Pathway
thp00520  Amino sugar and nucleotide sugar metabolism
thp01100  Metabolic pathways
thp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BG95_04825
Enzymes [BR:thp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BG95_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: APT72209
UniProt: A0A1L7BF62
Position
complement(958101..959153)
Genome map
AA seq 350 aa AA seqDB search
MIIEKALIVDPIEGEFTGDIEFDKKIINVKKYDCTPKLLLMPGFVDTHTHGYMGIDCMTA
TDKDFNIWGNKVLSNGVTYLFPTTVSHSFEVLNNVTQNFSNATHPSLMGLHFEGPFLNKK
KAGAQNKAYIQSFNDALPQLKNVKILSFAPELPNSKDLLEKLRKNNIVPSIGHSNANYKI
FKEFFDLDVKRITHFPNALSTLHHREVGIVGGVFLHKPYVEIIADFVHSSPEFLKLVYQT
LGAKKIILITDSISATGLGDGIYTLGNLLVKVKDNIARLEDGTLAGSTLKFIDGLKNFKK
ATNCSLKELSWVSSFNTLKNLKIDTGRIKIGYDAKFVLLNQDLNIIDTVV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgataatagaaaaagcactcatagttgatccaattgaaggagaatttacaggagatata
gaatttgataaaaagataataaatgtaaaaaaatacgattgtacccccaaacttttatta
atgccaggatttgtggatacacacacccacggatatatgggaatagattgtatgactgca
acagataaagattttaacatttgggggaataaggtcctatctaacggtgttacatatctt
tttcccactaccgtttctcattcttttgaagtactaaataatgtaacacaaaatttttca
aatgccacgcacccttcccttatgggattgcactttgaaggcccttttttaaataaaaag
aaagcgggagctcaaaacaaagcatatatacaatcttttaacgatgcacttccacaactt
aaaaatgtaaaaattttaagttttgcaccagaacttcccaattcaaaggatctactggaa
aaattaagaaaaaacaatattgttccttcaattggacattcaaatgcaaattacaagatt
tttaaagagttctttgaccttgatgttaaaagaattacacactttcccaatgccctatct
acgttacatcacagagaagttggcattgtaggtggtgtttttttacacaaaccgtacgtt
gagataattgcagattttgtacattcatctcctgaatttttaaaattagtataccaaaca
ctaggtgcaaaaaaaattatccttattacagatagtatatcagccacaggacttggcgat
ggtatttacacactgggaaatcttcttgtaaaggtaaaagataatatagcaaggcttgaa
gatggaacccttgcaggaagcacactaaaattcatagatgggctcaaaaatttcaaaaag
gccaccaattgctctctaaaagaactctcatgggtatcttcttttaacacacttaaaaat
ttaaaaatagacacaggacggatcaaaataggatatgatgctaagtttgtgttactaaat
caagacctaaatattatagatactgtggtataa

DBGET integrated database retrieval system