KEGG   Thermosipho sp. 1063: BG95_05285
Entry
BG95_05285        CDS       T04625                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
thp  Thermosipho sp. 1063
Pathway
thp00472  D-Arginine and D-ornithine metabolism
thp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BG95_05285
Enzymes [BR:thp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BG95_05285
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: APT72286
UniProt: A0A1L7BFD1
Position
1052017..1054209
AA seq 730 aa
MLDPKKPIDIDEILKDLDKYRPKRKGWVWRKRLPEGTKIGDYKYYQVSEDLKNSIPLPAA
HYFGSIDPQPEVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHYDGLIEGTP
EGIGGIPITRKQLRATRKALDLIEEEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQD
PQYNVLYRGINPIRSFVDAAVAKKIMASVNMLQIDGAHNANASAKLAWTVMPELLVQHGI
NCMYSLKAGMKKEYIALSTVPPVVAPMPEFRYNLPYAVALRELFDGFKFRAQMNTRYIES
DLFDATRIHVLNTLISRLTSADLQSTITPDEGRNVPWHVNSIRGVETAKHTLVALDGMKQ
YVKIDEKKIRERVRELKMRAILMLEEILDMGGYFEALEAGMFVDNGYYPERIGDGIARKK
DGEIAAGTVVPREADYMAPVCEHFGYNNLPKDIEKPCDLIGGCTLHNPDKIQFIDELDES
DNVNVRLEKIRDMRKRKVIKPEVEWFSDGWIQMDMTFALPKELAEAAAIALCEKLGLEEP
TIIHKTILHPSEGTYIEVKAKVPFEIEIDKLELPKKPETLPEEEIFEYVKNNPIHVVAGT
VGNDEHSVGLREILDIKHGGIEKYGIKYTYLGTSVPPEKLIDAAIETGAKAILASMIITH
NDVHVQNMKKIHELAIEKGIRNKVIIIAGGTQINNDLAIENGMDAGFGRGTKGIHVASFI
VKKLKEKESK
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgcttgatccaaaaaaacctatagatatagatgaaatattgaaagatttggataaatat
aggccaaagagaaaagggtgggtgtggagaaaaagacttcctgaaggtacgaaaatagga
gattacaagtactaccaagttagcgaagacttgaaaaattctattcctcttcccgctgca
cactattttggaagtatagatccacaacctgaggttgtaattacttcggaaattgcctct
ggaaggtttgaagatgatatcagaagaatgagaatggccgcttggcatggagcagaccat
attatggttataaggactttgggacaatcgcattacgatggacttattgaaggtacacca
gaaggtataggtggtattcccattacaagaaaacaacttagagctacaagaaaagcctta
gatttgatagaagaagaggtaggaagacctataaactttcacagttatgtgtcgggggtt
gctggacctgaaattgccgttttgtttgcagaagaaggggtaaatggagcgcaccaggat
cctcaatataatgttttgtataggggaattaaccctattcgttcatttgtagatgctgcc
gttgcaaagaaaattatggcttctgttaacatgttacagattgacggtgcacacaatgcc
aatgcctctgcaaagcttgcatggacagttatgcctgaacttttagtacagcatggaatt
aattgtatgtattctttaaaagcaggaatgaagaaagaatatattgcactttctacagta
ccacctgttgtagcaccaatgcccgagtttaggtataaccttccttatgcagtggcttta
agagaattatttgatggatttaaatttagagctcaaatgaatacaagatatatagaatcc
gatttatttgatgcgacaaggatacatgtgcttaatacattgatttcaagactaacctct
gctgatctacaatcaactattactccagatgaaggtagaaatgtgccgtggcatgtaaac
tcaatacgtggagtagaaacggcaaagcacaccttagtagcattagatggaatgaagcag
tatgtgaaaatagacgaaaagaaaattagggaaagggtcagagaacttaaaatgcgtgca
attttaatgcttgaagaaatattggatatgggaggatatttcgaagcgttagaagcaggg
atgtttgttgataatggatattatccagagagaataggagatggaattgcaaggaagaaa
gatggcgagatagctgcaggtacagtagtaccaagagaagcagattacatggcgccagtt
tgcgagcattttggttacaacaatttaccaaaagatatagaaaagccatgtgatttaatt
ggtggatgtactttacataatccagataaaatacaatttatagacgaattagatgaaagt
gataatgttaatgttagacttgagaagataagggatatgaggaaaagaaaggttattaaa
cctgaggttgagtggttttcagatggttggatccaaatggatatgacatttgcactacct
aaagaacttgcagaagctgctgctatagcgttgtgtgaaaaattagggcttgaggaacca
acgattattcataagacaatattacatccatctgaaggaacatatattgaagtgaaagca
aaggtgccatttgaaattgaaattgataaattggaacttccaaaaaaacctgaaactttg
cctgaagaagagatattcgaatatgtaaagaacaatcctatacacgtagttgccggtaca
gtggggaatgatgagcattctgttggattaagggaaatattggatattaaacatggagga
attgaaaagtatggtataaaatatacgtatcttgggacaagtgttccacccgaaaagctc
atagatgcagctattgagactggagcaaaggcaatacttgcatctatgattataacccac
aatgatgtgcacgtacaaaatatgaagaaaatccacgaattagctattgaaaaaggtata
aggaataaggttataattattgcaggtgggacacaaattaacaatgatttggcaattgaa
aatggtatggatgcaggatttggtcggggaacaaaaggaatacatgttgcttcatttata
gtaaaaaaattaaaggagaaagaatctaaataa

DBGET integrated database retrieval system