KEGG   Thermosipho sp. 1063: BG95_07010Help
Entry
BG95_07010        CDS       T04625                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
thp  Thermosipho sp. 1063
Pathway
thp00010  Glycolysis / Gluconeogenesis
thp00020  Citrate cycle (TCA cycle)
thp00620  Pyruvate metabolism
thp01100  Metabolic pathways
thp01110  Biosynthesis of secondary metabolites
thp01120  Microbial metabolism in diverse environments
thp01130  Biosynthesis of antibiotics
thp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG95_07010
   00020 Citrate cycle (TCA cycle)
    BG95_07010
   00620 Pyruvate metabolism
    BG95_07010
Enzymes [BR:thp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BG95_07010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: APT72610
UniProt: A0A1L7BG68
Position
1356090..1357709
Genome map
AA seq 539 aa AA seqDB search
MATREYFKIDEISVNNPLFSPMRATIETAFYRNNVELVTTPKEAYKLAKNSPGTIVTSWE
VYNPEMLGLERGTKVLLFNDGAVTGRYAAGRRILGTSDDNKYLEIVREAVYNTRYKKMYH
GISFSGLSEEFMVKNHILIPQGHEILLYNWLLNFQYPSQEYESMYRKSFRYNEGDIYIFV
DPDWKHPDFPLGLAIFDSEHNCAAILGMRYFGELKKGTLTLGWGIANRNGFVACHGGIKI
LKNEKTDFVAAFFGLSGSGKSTLTHTKHSKYDVTVLHDDAFIISTNSLSSVALEPSYFDK
TADYPSNSEDNKYLLSIQNCGVTKDENGNLIPVMEDLRNGNGRAIKSRLWSANRVDKFDS
PISAIFWLMKDPTLPPIVKIDSPNMASTMGALLTTKRTSAEKLDNDVDPNALVFEPYANP
FRTYPLKEDYEKFKFVFEKGVQCYILNTGYFINKKVPKHLTIQLVEDVVENNIEWVKWFG
TFYFAKIDGFLPNMEDREYIESLKKSFLKRKDFILSKKGTRDELPEEVLEAIEQIIGLL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaagagaatattttaagattgatgagatttcagtaaataatcctcttttttca
ccaatgcgagcgaccattgagactgctttttatagaaataatgtagaacttgttactact
cctaaagaagcatataaacttgcaaaaaattctccggggactatagtgactagttgggaa
gtttacaatccagaaatgcttggacttgaaagaggcacaaaagtattattatttaatgat
ggtgcggtaacgggtagatatgctgcaggtcgaagaatattaggtacaagtgatgataat
aaatatttggaaattgtccgtgaagcggtttataatacgagatataaaaaaatgtaccat
ggaatatcgttttcaggactttcagaggaatttatggtgaaaaatcatattttaatacct
caaggtcatgaaattttactttataattggctgttaaattttcaatatccttctcaggaa
tatgagagcatgtatagaaaatcttttagatataacgaaggagatatatatatttttgta
gatcctgattggaaacacccagatttcccattaggacttgcaatttttgattcagaacac
aattgtgcagctattcttggaatgagatattttggtgagttaaaaaaggggaccttaaca
cttggatggggtattgcaaataggaatggatttgtagcttgtcatggtggaataaagata
ttaaaaaatgaaaaaacggattttgtagccgcattttttggattgtctggatccggaaag
tcaacacttactcatacaaaacattcaaaatacgatgtaactgttttacatgatgatgcg
tttattatatcaactaattctttgtcatctgttgcacttgaaccatcttattttgataaa
acagcagattatccgtcaaattcagaagataataagtatttattatctatacagaactgt
ggtgttacaaaagatgaaaatggtaatttgattcccgtaatggaagatttaagaaatgga
aatggaagggcaataaaatcaaggctttggtcagctaatagagttgataagtttgatagt
cctattagtgcgatcttttggttaatgaaggatcctacattaccaccaattgtaaaaatt
gattctccaaatatggcatcgacaatgggtgctttgttaacaacaaaaaggacatctgca
gaaaagttggataatgatgttgatccaaatgcattggtttttgaaccatatgcaaatcca
tttagaacctatccgttaaaagaggattatgaaaaatttaaatttgtatttgaaaaagga
gttcaatgttatattttgaataccggatactttataaacaaaaaagtgccaaaacaccta
acaatacaattggttgaagatgtagtggaaaataacattgaatgggtaaaatggtttggg
actttttactttgcaaagattgatgggtttcttccaaatatggaggatagggaatatatt
gaatcgttgaaaaaatcgtttttaaaaagaaaagatttcattctttcgaaaaaaggtact
agagatgaacttccagaagaggttttagaagcaattgaacaaattatagggctgctttga

DBGET integrated database retrieval system