KEGG   Thermotoga sp. 2812B: T2812B_00235Help
Entry
T2812B_00235      CDS       T03494                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
thq  Thermotoga sp. 2812B
Pathway
thq00270  Cysteine and methionine metabolism
thq00920  Sulfur metabolism
thq01100  Metabolic pathways
thq01110  Biosynthesis of secondary metabolites
thq01130  Biosynthesis of antibiotics
thq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thq00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    T2812B_00235
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    T2812B_00235
Enzymes [BR:thq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     T2812B_00235
    2.3.1.46  homoserine O-succinyltransferase
     T2812B_00235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AIY85598
Position
41321..42235
Genome map
AA seq 304 aa AA seqDB search
MPINVPSGLPAVKVLAKEGIFVMTEKRAIHQDIRPLEILILNLMPDKIKTEIQLLRLLGN
TPLQVNVTLLYTETHRPKHTPIEHILKFYTTFSAVKDRKFDGFIITGAPVELLPFEEVDY
WEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYELPQKLSGVYKHRVAKDSVLFR
GHDDFFWAPHSRYTEVKKEDIDKVPELEILAESDEAGVYVVANKSERQIFVTGHPEYDRY
TLRDEYYRDIGRNLKVPIPANYFPNDDPTKTPILTWWSHAHLFFSNWLNYCIYQKTPYRL
EDIH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgccaataaacgttccaagcggtcttcctgctgtgaaagtcttggcaaaagaaggcatc
tttgtcatgacggaaaagagggcgatccaccaggacatccgccctcttgaaattctcatt
ctgaacctgatgccagacaaaataaaaacggagattcaacttctcagactccttggaaac
actcctcttcaggtgaatgtgacccttctctacactgaaactcacagaccgaaacacact
cccattgaacacattctgaagttctacacaactttttccgctgttaaagatagaaaattc
gatggattcatcatcacgggtgctcccgtggaactccttccgttcgaagaagtggattac
tgggaagaactcacagaaatcatggaatggagccgtcacaacgtgtactcgaccatgttc
atctgttgggcggctcaggcgggactgtactacttctacggaataccgaagtacgaactc
ccacagaagctctcaggcgtttacaagcacagagtcgcaaaagattcggtcctcttcagg
gggcacgacgacttcttctgggcgccgcactcgcggtacaccgaggtgaagaaggaagac
atagacaaagtaccggagcttgagatccttgcagagtcggacgaagctggtgtttacgtg
gttgcaaacaaaagcgaaagacagatattcgtcacaggacatcccgagtacgacagatac
acactgagagacgaatactatcgagatataggtcgaaatctgaaggtgccgattcctgcc
aattactttccaaacgacgatcccacaaaaactcccattctcacttggtggagtcacgct
cacctcttcttcagcaactggttgaattactgcatctaccagaaaacaccttacagattg
gaagacatacactga

DBGET integrated database retrieval system