KEGG   Thermotoga sp. 2812B: T2812B_05415Help
Entry
T2812B_05415      CDS       T03494                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
thq  Thermotoga sp. 2812B
Pathway
thq00260  Glycine, serine and threonine metabolism
thq01100  Metabolic pathways
thq01110  Biosynthesis of secondary metabolites
thq01120  Microbial metabolism in diverse environments
thq01130  Biosynthesis of antibiotics
thq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T2812B_05415
Enzymes [BR:thq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     T2812B_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP OKR_DC_1 Aminotran_3 Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AIY86624
Position
complement(1117088..1118119)
Genome map
AA seq 343 aa AA seqDB search
MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAEVFGKEAALFVPSGTM
GNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIR
PRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEIYTIAKEHGINVHIDGARIFNASIASG
VPVKEYARYADSVMFCLSKGLCAPVGSIVVGDRDFIERARKARKMLGGGMRQAGVLAAAG
IIALTKMVDRLKEDHENAKFLALKLKEIGYSVNPEDVETNMVILRTNNLKVNAHEFIEAL
RNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctcaggtctgacactgtcacaaaaccaacagaagagatgagaaaagccatg
gcacaggctgaggtgggagacgacgtctacggagaagatccaactatcaacgaactcgaa
agactcgccgcagaggtctttggaaaggaagcggctctctttgtaccctccggcaccatg
ggaaatcaagtgagcataatggctcacacccagaggggcgatgaagtgatactggaggca
gacagccacatcttctggtacgaggtcggagccatggcggttctctccggagttatgccc
catcctgtgcctggaaaaaatggagccatggaccccgatgatgtgagaaaagcaataaga
cccagaaacatacacttccccagaacttcgctcatcgccatcgaaaacacacacaaccgt
tccggtggaagagtggtcccgcttgaaaacataaaagagatttacacgatagccaaagaa
cacggcataaacgttcacatagatggtgcgaggatcttcaacgcctcaatcgcttcaggt
gttcccgtgaaggagtacgccaggtacgccgattccgtgatgttctgtctttcaaaaggt
ctctgcgcacccgtcggttcgatagttgtaggagacagagacttcatagaaagagcgaga
aaggcaagaaagatgctcggtggagggatgagacaggcaggtgttctcgctgccgctgga
ataatcgccttgacaaagatggtagatcgattgaaagaagatcatgagaacgccaaattt
ctcgccctgaagttgaaagaaatagggtactccgtgaatcccgaagatgtggaaaccaac
atggtgattctgaggaccaacaacctgaaggtgaacgcgcacgagttcatagaagcgctc
agaaacagcggggtactcgcgaacgccgtatccgacacggagatcagactggtaacccac
aaagacgtttcgagaaacgacatagaagaggctctgaacatcttcgaaaaactcttcaga
aaattctcctga

DBGET integrated database retrieval system