KEGG   Thermotoga sp. RQ7: TRQ7_08560Help
Entry
TRQ7_08560        CDS       T03669                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
thr  Thermotoga sp. RQ7
Pathway
thr00030  Pentose phosphate pathway
thr00480  Glutathione metabolism
thr01100  Metabolic pathways
thr01110  Biosynthesis of secondary metabolites
thr01120  Microbial metabolism in diverse environments
thr01130  Biosynthesis of antibiotics
thr01200  Carbon metabolism
Module
thr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
thr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:thr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TRQ7_08560
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TRQ7_08560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thr04147]
    TRQ7_08560
Enzymes [BR:thr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     TRQ7_08560
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     TRQ7_08560
Exosome [BR:thr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TRQ7_08560
  Exosomal proteins of colorectal cancer cells
   TRQ7_08560
  Exosomal proteins of bladder cancer cells
   TRQ7_08560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJG41493
UniProt: A0A0B5KM84
Position
1647562..1649061
Genome map
AA seq 499 aa AA seqDB search
MRCRLGLKECPKNDAGILRCFPKIEQPFGMVIFGASGDLTKRKLVPALNRLFEAEILPER
FFVLGAARTRMGDEEFRSRFNTQPDLLKRFSYTRVDYQNPDTFKSLKRVVDDLMKRFGVR
NLIFYLSVPPDVYVPIIENLSKAGLNTETSRIVIEKPFGKDLKSARELEQVLQRSFGEHQ
IFRIDHYLGKETVQNILVFRFANFIFEEIWNNKFVDHVQITIAEDIGVEHRAGYFENTGL
LRDIFQNHMLQILALITMEPPSSFNGESFRSERVKLLRSIRPFPVEDLENWIVRGQYGRG
TVNGRVVPAYREEPGVSKNSSVETFVAMKLFIDNWRWSGVPFYLRAGKRLPKKVTEVAVV
FKRIPHSIFPNVPSKDLEPNTIIFTIQPNEAISLEFQVKRPCPGMTPQLLSMDFRYEDYF
GVKLPDAYERLLLDVILGDTTLFMRRDDLEVSWELLDPVLKAWESDPVRFEPHIYPSGTW
GPKEADLLIERDGRRWRRP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgcagactgggactgaaagaatgcccgaaaaacgatgcgggaatccttcgttgt
tttccaaaaatcgaacaaccctttggaatggtgatattcggtgcttcgggtgatctgacg
aaacgaaaactcgttccggcactgaacaggttgtttgaagccgaaatcttaccggagcgc
ttctttgttctcggtgcagcaagaacgaggatgggtgatgaggaattcagatccagattc
aacacccagcccgatcttctgaaacgcttcagctacacaagggtagactatcaaaacccc
gatacctttaagtcgctgaaaagagtcgttgacgacctcatgaaaagattcggagtcagg
aatttgatcttctacctctctgttccacccgatgtgtacgttcccataatcgaaaacctc
tcaaaggccggcttgaacacagaaacatcccgcattgtgatagaaaaaccgtttggaaag
gacctgaaatccgcaagagaactggagcaggtgcttcagagatcctttggtgaacaccag
atattcaggatcgatcattaccttggaaaggaaaccgttcaaaacatcctggtgttcagg
ttcgcaaacttcatattcgaggagatatggaacaacaagttcgtggatcacgttcagatc
acgatagcagaggatatcggtgtggaacacagggcgggatattttgaaaacacaggactt
ctcagagacatctttcaaaaccacatgcttcagatcctcgcactcatcaccatggaacct
ccttcttccttcaacggggaaagcttcagaagtgaaagggtgaaacttctcagatctatc
agaccgtttcccgtggaagatctcgaaaactggatcgtcaggggacagtacggaagagga
actgtgaacggaagagtcgttcccgcttatagagaagagccgggggtgtcgaagaattcc
agtgtcgaaacgtttgttgccatgaaactcttcatagacaactggagatggagcggcgtg
cccttctacctgagggcgggaaagcgacttccaaagaaagtgacggaggtggcggtggtt
ttcaagaggattccgcactcgatattccccaacgtaccctcaaaagacctcgaacccaac
acgatcattttcaccatacaaccaaacgaggcgatctctctggagtttcaggtgaaaaga
ccatgtcccggtatgacccctcaacttctcagtatggacttcagatacgaggactacttc
ggagtgaaactcccggacgcctacgaaagacttcttctggatgtgatactcggggatacg
acgcttttcatgagaagggatgatcttgaagtctcatgggaactcctcgatcctgttttg
aaggcatgggagagcgatccggtgcgcttcgaacctcacatctatccatccggaacctgg
ggcccgaaggaagcagatcttctcatagaaagggatggcagaagatggcgaagaccgtga

DBGET integrated database retrieval system