KEGG   Thalassotalea sp. HSM 43: E2K93_07450Help
Entry
E2K93_07450       CDS       T05926                                 

Definition
(GenBank) SMP-30/gluconolactonase/LRE family protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
tht  Thalassotalea sp. HSM 43
Pathway
tht00053  Ascorbate and aldarate metabolism
tht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    E2K93_07450
Enzymes [BR:tht01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     E2K93_07450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Arylesterase
Motif
Other DBs
NCBI-ProteinID: QBY04232
UniProt: A0A4P7JSK5
Position
complement(1738383..1739282)
Genome map
AA seq 299 aa AA seqDB search
MANVKVGKLLLEIEVTNTLAEGVQWHPETESIWWTDIEGLALYSFHLPSKSVIKHSTPYR
VGCFAFIENDPRLLVAFEQGIAFYQIDSQEVQWLAKPEAQLPTHRFNDGRVDRQGRFWAG
TMLEDQSLSTRAGLYKYSAAEQAQKMIDDVLISNGLCWSPCSNVMYHADSPKHEIYRYQF
EPISGEIKHKSLFAQTAQNCFPDGSTVDSQGFLWNAQWGGSKVVRYAPDGRIDMELFVPV
SQPSCVAFAGTQLDLLVVTSARQGLSAEQIASQPKAGNLFIYQLHGIHGLAESKFVLPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgtgaaagttggcaagttattgcttgagattgaggtaaccaataccttggcg
gaaggggtgcaatggcaccctgaaaccgagtcgatttggtggaccgatattgaaggactc
gccttgtacagctttcacttgccaagcaagtcagttatcaaacactcgacaccataccgt
gttgggtgttttgcttttattgaaaacgacccgcgtcttttagttgcctttgagcaaggt
attgccttttaccaaatagacagccaagaggtgcaatggctggcaaaaccggaagcgcaa
ttacctacccatagattcaatgatggccgagtcgatcgacaaggtcgcttttgggctgga
accatgcttgaagaccaaagtttgtctactcgtgcgggtctgtacaaatacagcgcagca
gagcaagcgcagaagatgattgatgatgtgcttatttctaacggtctatgttggagtcca
tgttcgaatgttatgtaccatgcggattcacctaagcatgaaatttatcggtatcagttt
gagccaatatcgggtgagataaagcataagtcgttgtttgcacaaaccgcacagaactgc
tttcctgacggttcgacagtagattctcaaggatttctttggaacgctcaatggggtggt
tctaaagtcgttcgttacgcccctgacggccgtatcgatatggagttatttgtgcctgta
tcgcaaccatcatgtgttgcctttgctggaacgcagctagatttattggttgttaccagc
gcaaggcagggcttgtcagccgagcaaatcgcctcgcaacctaaggctggtaatcttttc
atatatcaattgcacggtattcatggcttggccgaatctaaatttgtgctgcccgcataa

DBGET integrated database retrieval system