KEGG   Thalassotalea sp. HSM 43: E2K93_09820Help
Entry
E2K93_09820       CDS       T05926                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
tht  Thalassotalea sp. HSM 43
Pathway
tht00670  One carbon pool by folate
tht01100  Metabolic pathways
tht01120  Microbial metabolism in diverse environments
tht01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tht00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    E2K93_09820 (metF)
Enzymes [BR:tht01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     E2K93_09820 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: QBY04669
Position
2292089..2292979
Genome map
AA seq 296 aa AA seqDB search
MNAKARQLDLLNRTVRDLDRDLNVSFEFFPPNSEQMETTLWNSVERLEPLNPSFVSVTYG
AGSGTRDRTHGVIKRIQRDTSLVAAPHLTCIDASKQELIDIAKDYWQSGVRHIVALRGDL
PNSSEKPNMYASDLVEVLKGVADFEISVAAYPETHPESPNAQFDLVNLKRKIDAGATRAI
SQFFFDIDAYLRFRDRCVAVGIDVEIVPGILPVSNFATLKRFAGLTNVHVPDWMGKLYEG
LDDDPTTRNMVGANIAMEQVKILRSEGVNDFHFYTLNRSELTYAICHTLGIRPQQG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctaaagctcgccaacttgatttgttaaatcgtactgtccgtgatttggatcgc
gacttaaatgtgtcatttgaattcttcccaccaaactcagaacaaatggaaaccacctta
tggaattcggtagaacgtctagaaccgcttaatcctagttttgtgtcagtaacctatggc
gctggcagtggtacccgagatagaacacacggcgttattaagcgaattcaacgtgacacc
agcttagttgctgcaccacatttgacttgtattgatgccagtaaacaagagttaatcgat
attgccaaagactattggcaaagcggtgttcgtcacattgttgcgttacgtggtgattta
ccaaacagcagtgaaaaaccaaatatgtatgccagcgacttagtcgaggtattaaaaggt
gttgccgactttgagatctctgttgccgcctatccggagactcatcctgaatcgcctaat
gcgcaatttgatttggttaacttgaaacgaaaaattgatgctggcgcgacacgtgctatc
tcgcaattcttttttgatatagacgcctatttacgttttcgtgaccgttgtgttgcggtt
ggtattgatgtcgaaattgtcccgggtattttgccggtatcaaattttgccactttaaaa
cgctttgcagggttaaccaacgtgcatgtacctgactggatggggaaattgtacgaagga
ctcgatgacgacccgactacgcgaaacatggtcggtgccaatatcgcaatggaacaggtg
aagatattacgtagcgaaggggttaatgactttcatttttatacgctaaatcgttccgaa
ttaacctatgcaatttgtcacaccttaggtattcgcccacaacaaggttaa

DBGET integrated database retrieval system