KEGG   Thalassotalea sp. HSM 43: E2K93_10955Help
Entry
E2K93_10955       CDS       T05926                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
tht  Thalassotalea sp. HSM 43
Brite
KEGG Orthology (KO) [BR:tht00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    E2K93_10955 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: QBY04868
UniProt: A0A4P7JRL5
Position
complement(2542291..2542677)
Genome map
AA seq 128 aa AA seqDB search
MSSNDPGQLVKVTTSVDFIEEQSDSYQNRFVFSYTITIENNSDKTLQLISRSWLITDANG
HKVTVEGDGVVGQQPILNSGQRYRYSSGSIIKTPIGAMEGFYTMRDLDKNQYRVDIPVFG
LAVPNMLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaatgatccaggacaacttgtcaaagtcacaacctcagtagattttatcgag
gaacaatcggacagttaccagaatcgctttgtattcagctatacaattacgatagagaat
aatagcgacaagactttacagcttatttcccgcagctggttaataaccgacgccaatggt
cacaaagtcacagttgaaggcgatggcgtcgtcggccaacaacctatcttaaacagcggt
cagcgttaccgttattcaagtggttcaattattaagacccctattggtgctatggagggg
ttttacaccatgcgtgacctcgacaagaaccaatatcgcgtcgacattccagtcttcggt
ctcgccgttcctaatatgttgaactag

DBGET integrated database retrieval system