KEGG   Thauera humireducens: AC731_004970Help
Entry
AC731_004970      CDS       T04211                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
thu  Thauera humireducens
Pathway
thu00051  Fructose and mannose metabolism
thu00520  Amino sugar and nucleotide sugar metabolism
thu01100  Metabolic pathways
thu01110  Biosynthesis of secondary metabolites
thu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AC731_004970 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    AC731_004970 (cpsB)
Enzymes [BR:thu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AC731_004970 (cpsB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     AC731_004970 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding CENP-C_C
Motif
Other DBs
NCBI-ProteinID: AMO36337
UniProt: A0A127K301
Position
complement(1056942..1058387)
Genome map
AA seq 481 aa AA seqDB search
MIIKSVILSGGSGTRLWPASRESYPKQLLPLTGERSLLQETGLRLKDFGAREVDPRPLVV
TNEEYRFIIAEQLRQIGVRAPQIVLEPFGRNTAPALTLAALAAQEEGDPILLVMPADHVI
TDIAAFQQSIADGSAFAADGALVTFGIVPDRPETGYGYIRSGEALAEGRLGRALVEFVEK
PDRDTAQRYVDSGEYFWNSGIFMMKASVWLRAIRHFNPDMANACEAAYAGRKPDADFIRL
EQGAFERCPSDSIDYAVMERLADAPELGTGVVVPMAAGWSDVGAWDALWAVSDKDAAGNA
GRGQVLFEDCRNTLVHSGSRLVAAVGCDDMVVVETPDAVMVAHKDHTQDVKKVVARLKAE
GRSLTKSHRKVYRPWGWYDSIDAGERFQVKRIVVNPGAKLSLQMHHHRAEHWVVVKGTAE
VTCGERTFLLGENESTYIPLGHTHRLANPGKVPLEIIEVQSGSYLGEDDIVRFEDTYGRS
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaagagcgtcattctttccggcggatcgggcacgcggctctggccggcgtcg
cgcgagagctatccgaagcaactcctgccgctgaccggcgagcgttcgctgctgcaggaa
acgggcttgcggctgaaggacttcggcgcgcgggaggtggatccgcgtccgctcgtcgtg
accaacgaggaataccgcttcatcatcgccgaacaattgcgccagatcggcgtacgcgct
ccgcagatcgtgctcgaacccttcgggcgcaacaccgcgccggcgctgacgctcgccgcg
ctggccgcacaggaggagggcgatccgatcctgctggtgatgccggcagaccatgtcatc
accgacatcgccgccttccagcagtcgatcgcggacggcagcgccttcgctgcggatggc
gccctggtcaccttcggcatcgtgccggaccggcccgaaacgggttacggctacatccgc
agcggcgaggcactcgcggaggggcgccttggtcgagccttggtcgaattcgtcgagaaa
cccgaccgcgacaccgcgcagcgttacgtcgatagcggcgagtacttctggaacagcggc
atcttcatgatgaaggcctcggtgtggctgcgggcgatccgccacttcaacccggatatg
gcgaacgcctgcgaggcggcctatgcgggtcgcaagccggatgccgatttcatccgcctg
gagcagggcgctttcgagcgctgcccgagcgactcgatcgactatgcggtcatggaacgg
ctcgccgacgcgcctgagcttggtacgggcgtggtggtaccgatggcggccggctggtcg
gacgtcggcgcctgggacgcgctgtgggccgtgtcggacaaggatgccgccggcaacgcg
gggcgtggtcaggtgctgttcgaggactgccgtaacacgctggtgcattcgggcagccgc
ctggtggcggcggtcggctgcgatgacatggtcgtggtggaaacgccggacgcggtgatg
gtggcgcacaaggaccatacgcaggacgtgaagaaggtcgtcgcgcgcctcaaggccgaa
ggccgcagcctgacgaagagccatcgcaaggtgtatcgcccgtggggctggtacgactcg
atcgatgcgggcgagcgcttccaggtgaagcgcatcgttgtcaatccgggcgccaagctc
agcctgcagatgcatcaccaccgggccgagcactgggtcgtggtcaagggcacggccgaa
gtcacctgcggcgaacggaccttcctgctgggtgagaacgagtcgacctacatcccgcta
ggtcatacacaccggctcgcgaatccgggcaaggtgccgctggagatcatcgaggtgcag
tcgggcagctatctcggcgaggacgacatcgtgcgcttcgaggacacctacggacgcagc
agctga

DBGET integrated database retrieval system