KEGG   Thauera humireducens: AC731_008475Help
Entry
AC731_008475      CDS       T04211                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
thu  Thauera humireducens
Pathway
thu00071  Fatty acid degradation
thu00072  Synthesis and degradation of ketone bodies
thu00280  Valine, leucine and isoleucine degradation
thu00310  Lysine degradation
thu00362  Benzoate degradation
thu00380  Tryptophan metabolism
thu00620  Pyruvate metabolism
thu00630  Glyoxylate and dicarboxylate metabolism
thu00640  Propanoate metabolism
thu00650  Butanoate metabolism
thu00900  Terpenoid backbone biosynthesis
thu01100  Metabolic pathways
thu01110  Biosynthesis of secondary metabolites
thu01120  Microbial metabolism in diverse environments
thu01130  Biosynthesis of antibiotics
thu01200  Carbon metabolism
thu01212  Fatty acid metabolism
thu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AC731_008475
   00630 Glyoxylate and dicarboxylate metabolism
    AC731_008475
   00640 Propanoate metabolism
    AC731_008475
   00650 Butanoate metabolism
    AC731_008475
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AC731_008475
   00072 Synthesis and degradation of ketone bodies
    AC731_008475
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AC731_008475
   00310 Lysine degradation
    AC731_008475
   00380 Tryptophan metabolism
    AC731_008475
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AC731_008475
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AC731_008475
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AC731_008475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thu04147]
    AC731_008475
Enzymes [BR:thu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AC731_008475
Exosome [BR:thu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AC731_008475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMO36980
UniProt: A0A127K4U4
Position
complement(1784516..1785667)
Genome map
AA seq 383 aa AA seqDB search
MAEAYIVDALRSPTGKRKGGLSHVHAIDLGAHVLKALVERNAIPADEYDDVIFGCVDTIG
SQAGDIARTAWLAAGLPLNVPGTTVDRQCGSSQQAVHFAAQAVMSGTQDVVAVGGVQTMT
QIPISSAMLAGQPLGFPDPFSGSKGWKARFGDQPVNQFYSAQRIADHWNLSRRDMEVYAL
ESHRRALAAIAEGRFEREIVGLEGVTKDETPRVSTLEKMAELEPVGPEYPSITAAVSSQT
CDASAALLVVSEAALKRYNLTPRARIHHLSVMGDDPIWHLTAPIPATRAALNKTGMRMSD
IDVVEINEAFASVVMAWQKELDYDPARMNPNGGAIALGHPLGATGARLMTTLLHELERSG
GRFGLQTMCEGGGQANVTIIEKL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcctatatcgtcgatgccctgcgcagccccaccggcaagcgcaagggcggt
ctgtcccacgtgcatgcgatcgacctcggcgcgcatgtcctcaaggcgctcgtcgagcgc
aacgccattcccgccgacgaatacgatgacgtgatcttcggctgcgtcgacaccatcggc
tcgcaggcgggcgacatcgcacgtaccgcgtggctggccgccggcctgccgctgaacgtg
cccggcactacggtggatcgccagtgcggctcctcgcagcaggcggtgcacttcgccgcg
caggcggtgatgagcggcacgcaggacgtggtcgcggtcggcggcgtgcagacgatgacg
cagatcccgatctcgtccgccatgctcgccggccagccgctcggctttcccgacccgttc
tcgggcagcaagggctggaaggcgcgcttcggcgaccagccggtgaaccagttttattcc
gcgcagcgcatcgccgaccactggaatctcagccgccgcgacatggaggtctatgcgctc
gagagccaccgccgggcgctcgccgccatcgccgagggccgcttcgagcgtgagatcgtc
ggcctcgaaggcgtgacgaaggacgagacgccgcgtgtcagcacgctcgagaagatggcc
gagctggagccggtcggccccgagtacccgtcgatcaccgcggcggtgtcgagccagacc
tgcgacgcttcggccgcgctgctggtggtgtccgaagccgcgctcaagcgctacaacctg
acgccgcgcgcgcgcatccatcacctgtcggtgatgggcgacgacccgatctggcacctc
accgcgccgattcccgccacccgcgccgcgctcaataagaccggcatgcgcatgagcgac
atcgatgtggtcgagatcaacgaggccttcgcctcggtggtcatggcctggcagaaggag
ctggactacgaccctgcgcgcatgaaccccaacggcggcgcgatcgcgctcggccatccg
ctcggtgccaccggcgcgcgcctgatgaccacgctgctgcacgaactcgagcgcagcggc
ggccgtttcggcctgcagaccatgtgcgaaggcggtggccaggccaacgtcaccatcatt
gaaaagctgtaa

DBGET integrated database retrieval system