KEGG   Thauera humireducens: AC731_008560Help
Entry
AC731_008560      CDS       T04211                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
thu  Thauera humireducens
Brite
KEGG Orthology (KO) [BR:thu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AC731_008560
Enzymes [BR:thu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     AC731_008560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AMO36996
UniProt: A0A127K4X4
Position
1803150..1805249
Genome map
AA seq 699 aa AA seqDB search
MRRFTLKPLLALLAAGSVLVAQAPAFAASPAPASRPETGGEWPRHGLDAAETRFSPLSAI
SADNVGRLGLAWHFRFDRPRGVEATPIMVDGTLYVSGPWGVVYAVDARNGQLRWQHDPEV
PAGKGMHACCDVVNRGVAVEDGRVFVATIDGRLQALDAQSGRLLWSMRTFAIDAPYTITG
APRVARGLVIIGNGGAEYGVRGFVSAYDAQTGELRWRFYTVPGNPADGPDGAISDRPLQD
IALPTWRGEWSRYGGGGTVWDSMAWDPELDLLYVGVGNGSPHDRDVRSPGGGDNLFLSSI
VAIRRTTGEYVWHYQTTPGDSWDYTATQHMILAELEIDGRARKVLMQAPKNGFFYVLDRT
TGELLSAEKYVPVNWASHVDPASGRPVETEGARYPAGQPFMVQPSQLGGHNWQPMAWSPN
TGLVYIPAQENTGFMMKEPDFRFEPDRWNTGVLNPPMPPDPSLLAQAKASMRGHLLAWDP
VRRTAAWRTQHNSSWNGGVLATAGGLVFQGVGGEGLAAFDARDGRRLWQSDTWLDILGGP
ISYVLDGEQYVAAAAGFGSSIHLTSSSLLPRTGAPVPGGLFVWKLDGRAAMPTPESRPDL
TPPADEGTEGQIQQGGALYARYCMQCHGAGAMAGGGMPDLRHSPYLTDAALFRRPLIDGV
LSARGMPDFGKTLQPAQADAIRAYVIRMAHAMRAGAASR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcttcaccctcaagccgctgctcgccctgctggcggcaggcagcgtcctcgtc
gcacaggcgcccgccttcgccgcgtcgcccgcccccgcgtcccgacccgaaacggggggc
gagtggccccgacatggactggacgccgccgagacccgcttcagccccctgtccgcgatc
agcgcggacaacgtcggacggctgggactggcctggcacttccgcttcgaccggccgcgt
ggcgtcgaggccacccccatcatggtggacggcacgctatacgtcagcggcccgtggggc
gtggtgtatgccgtcgacgcgcgcaacggccagctcagatggcagcacgatcccgaggtg
ccggccggcaagggcatgcacgcatgctgcgacgtggtcaatcgcggcgtggcggtcgaa
gacgggcgcgtcttcgtggccaccatcgacggcagactgcaggctctggatgcgcaaagc
ggccgcctgctgtggtcgatgcggaccttcgccatcgacgcgccctacaccatcaccggc
gctccgcgcgtggcgcgcggcctggtcatcatcggcaacggcggcgccgaatacggcgtg
cgcggtttcgtttctgcctacgacgcacagaccggcgaactgcgctggcgcttctatacc
gtgccgggcaatccggccgacggccccgacggcgccatctccgaccgcccgctgcaggac
atcgcactgccgacctggcgcggcgaatggtcgcgctacggtggtggcggcaccgtctgg
gactcgatggcctgggatccggaactggacctcctttacgtcggcgtcggcaacggctcg
ccgcacgaccgcgatgtccgcagtcccggcggtggtgacaacctgttcctgtcctcgatc
gtcgcgatccgccgcaccaccggcgagtacgtctggcactaccagaccacgccgggcgac
agctgggactacaccgccacccagcacatgatcctggccgagctcgagatcgacggtcgt
gcgcgcaaggtgctgatgcaggcaccgaagaacggcttcttctacgtactggaccggacg
acgggcgaactgctctccgcggaaaaatacgtccccgtcaactgggccagccacgtcgac
cccgccagcggccgtccggtcgaaaccgagggcgcgcgttaccccgccggccagcccttc
atggtgcagccttcgcagcttggcggccacaactggcagcccatggcctggagcccaaac
accggcctggtctacatcccggcgcaggagaacacaggcttcatgatgaaggagccggac
ttccgcttcgagcccgaccgctggaacaccggcgtcctgaacccgccgatgccgcccgac
ccgtccctgctcgcgcaggccaaggcatcgatgcgggggcacctgctggcctgggacccg
gtacgtcgtaccgccgcatggcgcacgcaacacaatagctcgtggaacggcggcgtactc
gccactgccggcggtctggtgtttcagggcgtcggcggcgagggacttgccgccttcgac
gcgcgggatggacgtcgtctgtggcagtcggatacctggctcgacattctcggcgggccg
atcagctacgtgctcgatggcgaacagtacgtcgccgcagccgccggcttcggaagctcc
atccatctcacctcgagttccctgttgccgcgcaccggcgcaccggtaccgggcggtctg
ttcgtctggaaactggacgggcgggcggcaatgcccacgcccgaaagccggccggacctc
accccgcctgccgacgagggcaccgagggccagatccagcagggcggcgcgctctatgcc
cgatactgcatgcagtgccatggcgcaggggcgatggccggcggcggcatgcccgacctg
cgccactcgccctacctcaccgacgccgccctgttccgccgcccgctcatcgacggcgtg
ctgtcagcgcgtggcatgccggacttcggcaagacgctgcagccggcgcaggccgatgca
atccgtgcctacgtgatccgcatggcgcatgccatgcgcgccggcgccgcatcgcgctga

DBGET integrated database retrieval system