KEGG   Thauera humireducens: AC731_013430Help
Entry
AC731_013430      CDS       T04211                                 

Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
thu  Thauera humireducens
Pathway
thu00670  One carbon pool by folate
thu01100  Metabolic pathways
thu01120  Microbial metabolism in diverse environments
thu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AC731_013430
Enzymes [BR:thu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AC731_013430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Rsa3
Motif
Other DBs
NCBI-ProteinID: AMO37853
UniProt: A0A127K7B3
Position
2858520..2859353
Genome map
AA seq 277 aa AA seqDB search
MSIDISIEFFPPNTAEGADKLRATRDKLAALKPAFFSVTYGAGGSTRERTFATVKEIAAA
GYEAAPHLSCIGSTRDSIREILREYADAGIRRIVALRGDLPSGAGAAGEFRYANELVEFI
RAETGDRFLIEVAAYPEWHPQARSPKDDLLAFKRKADAGANSAITQYFYNLDAYLHFVDA
VRKLGVDIPIVPGIMPIGSFSKLARFSDACGAEIPRWMRKTFESYGDDADAIRAFGLDVV
TRLCEKLIAEGAPGLHFYSMNMAGPTIEICRRLGLHH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgacatctcgatcgagttcttcccccccaacaccgccgaaggcgccgacaag
ctgcgtgccacgcgcgacaagctggcggccctgaagcccgccttcttctccgtcacctat
ggcgccggcggctccacccgcgagcgcaccttcgccaccgtcaaggaaatcgccgccgcc
ggctacgaggcggcaccgcacctgtcctgcatcggctcgacccgcgacagcatccgcgag
atcctgcgcgaatacgccgacgccggcatccgccgcatcgtcgcgctgcgcggcgacctg
ccttcgggcgcaggcgcggcaggcgagttccgctatgccaacgagctggtggagttcatc
cgcgccgaaaccggcgaccgcttcctcatcgaagtcgccgcctacccggaatggcacccg
caggcccgcagcccgaaggacgacctgctcgccttcaagcgcaaggccgacgccggcgcc
aattccgcgatcacgcagtacttctacaacctcgacgcctacctgcacttcgtcgatgcg
gtgcgcaagctgggtgtcgacatccccatcgtgcccggcatcatgccgatcggcagcttc
agcaagctggcgcgcttctccgacgcctgcggcgccgagatcccgcgctggatgcgcaag
accttcgagagctacggcgacgacgccgatgcgatccgcgctttcggcctcgacgtggtc
acccgcctgtgcgagaagctgatcgccgagggtgcgcctggactgcacttctacagcatg
aacatggccggcccgacgatcgagatctgccgccggctcgggctgcaccactga

DBGET integrated database retrieval system