KEGG   Thauera humireducens: AC731_018625Help
Entry
AC731_018625      CDS       T04211                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
thu  Thauera humireducens
Brite
KEGG Orthology (KO) [BR:thu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AC731_018625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4352 DUF4354
Motif
Other DBs
NCBI-ProteinID: AMO38785
UniProt: A0A127K9Y8
Position
complement(4012537..4012932)
Genome map
AA seq 131 aa AA seqDB search
MSTPETPDARYHIEVSAVAEHIAPQSRPEDDHYVFAYHITIRNTGREPAQLLSRHWIITD
GNGKVQEVHGQGVIGEQPTLAPGESFRYTSGCVMETPVGTMHGSYQMVAGDGHHFDAVIP
PFMLAVPRVLH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccccagagacccctgacgcgcgctaccacatcgaagtgagcgcagtcgccgag
cacatcgccccgcagtcccggccggaagacgaccactacgtcttcgcctatcacatcacc
atccgcaacaccggccgcgagccggcccagttgctgagccggcactggatcattaccgac
ggcaacggcaaggtgcaggaagtgcacgggcagggcgtgatcggcgaacagccgaccctg
gcgccgggcgagagctttcgctacaccagcggctgcgtgatggagacgccggtcggcacc
atgcacggcagctaccagatggtggccggcgacggccatcatttcgatgcggtcatcccg
cctttcatgctggcggtgccgcgggtcctccactga

DBGET integrated database retrieval system