KEGG   Thioclava nitratireducens: BMG03_04905Help
Entry
BMG03_04905       CDS       T04697                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
thw  Thioclava nitratireducens
Pathway
thw00040  Pentose and glucuronate interconversions
thw00053  Ascorbate and aldarate metabolism
thw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMG03_04905
   00053 Ascorbate and aldarate metabolism
    BMG03_04905
Enzymes [BR:thw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BMG03_04905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQS47213
Position
976639..978153
Genome map
AA seq 504 aa AA seqDB search
MTFTPHGQHLIAGDWVGTDKTFSSDPAHGPSHEFCVGTVEMVNAACEAAEEAFWDYGYSS
RETRATFLEAIADEIDARGEAITEIGTQESGLPEARLNGERGRTVGQLRLFASHIRNGDY
LDRRHDKALPDRQPLPRPDLRMMQRPIGPVAVFGASNFPLAFSTAGGDTAAALAAGCPVV
VKGHSAHPGTGEIVAEAIKAAVEKTGMPKGVFSLIQGGRRDVGQGLVQHPLIKAVGFTGS
LGGGRALFDLCAQRPEPIPFFGELGSVNPMFLLPEAAKARGAEIGTGWAGSLTMGAGQFC
TNPGIAVVEDGPAGDAFVAAAKEALSASGPQVMLTDGIAQAYRDGKDRFDTRNSVTPVLT
TEQEGRNASPNLYETSAENYLQDHALGEEVFGPLGLVVRVSNSAQLVDLAKGFEGQLTAT
MHLDDGDAELARKLLPVLERKAGRVMANGFPTGVEVSDAMVHGGPYPASTNFGATSVGTL
SIRRFLRPVCYQNIPEGVLPADLA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaccccgcacggacaacacctgatcgctggcgactgggtcggcaccgacaag
actttctcctccgacccagcccacgggccgagccatgagttctgcgtcggcacggtcgag
atggtgaatgcggcctgcgaggcagccgaggaggcgttctgggactacggctattcgagc
cgtgagacccgcgcgacgttcctggaggccatcgctgacgaaatcgatgcacgcggcgag
gcgatcaccgagatcggcactcaggaaagcggtttgcccgaggcccgcctgaacggcgag
cgcgggcgcacggtaggccagctgcgcctctttgccagccatatccgcaacggcgactat
ctcgaccgccgccatgacaaggcactccccgatcgccagccgctgccgcgtcccgatctg
cggatgatgcagcgtccgatcggtccggtcgcggtcttcggcgcgtcgaacttcccgctg
gcgttttcgacggcgggcggcgacaccgccgccgcgctggccgcaggctgcccggtcgtg
gtgaagggccactccgcccatccgggcaccggcgaaatcgtggccgaggcgatcaaggcc
gcagtcgagaagaccggcatgcccaaaggcgtcttcagtctgattcagggcggacgccgt
gacgtggggcaagggctcgtgcagcatccgctgatcaaggcggtgggcttcactggtagc
ttgggcggtggtcgtgcgctcttcgatctctgcgcgcagcgccccgagccgatccctttc
ttcggcgaacttggctcggtgaacccgatgttcctgctgcctgaggcggcgaaggcgcgc
ggcgccgagatcggcaccggctgggcaggctcgctgacgatgggcgcgggccagttctgc
accaacccgggcatcgccgtggtcgaggacggcccggcaggcgacgccttcgtcgccgcc
gcgaaagaggcgctgtcggcctccggcccacaggtcatgctgacggacggcatcgcgcag
gcctatcgcgacggcaaagaccggttcgatacgcgaaactccgtgaccccggtgctgacg
accgagcaggaaggccgcaacgcctccccgaacctctacgagacgagcgccgagaactac
ctgcaggatcatgcgcttggcgaagaagtcttcgggccgctcggtctggtcgtgcgggtc
tctaactcggcgcagctggttgacctcgcgaagggtttcgagggtcagctgaccgcgacg
atgcatctcgatgacggcgatgccgagctggcgcgcaagctgctgccggtgctcgagcgc
aaggcgggccgcgtgatggcgaacggcttcccgaccggtgtcgaggtcagcgatgcgatg
gtccatggcgggccctatccggcgtccacgaacttcggcgcgaccagtgtcggcacgctc
tcgatccggcgcttcctgcgcccggtctgctaccagaacatccccgagggcgtgctgccc
gcggaccttgcgtga

DBGET integrated database retrieval system