KEGG   Thioclava nitratireducens: BMG03_08145Help
Entry
BMG03_08145       CDS       T04697                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
thw  Thioclava nitratireducens
Pathway
thw00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMG03_08145
Enzymes [BR:thw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BMG03_08145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AQS47777
Position
1688084..1688773
Genome map
AA seq 229 aa AA seqDB search
MKRSRVNEIMAAAEDMIQEFGFRLPPFAWWSPAEFKARLPQAQRIVEAAMGWDITDYGQG
DFDKLGLFLFTLRNGDLRDLQAGHGMAYAEKLLISRKDQISPMHTHIIKAEDIINRGGAN
LAIELYGSDADGKFDDTAGGQVMCDGVPRRYEPGEVLILRPGESVTLRPGDWHAFWGEGG
DVLIGEVSTVNDDNTDNIFREDIGRFSEIEEDEAPRHLLVSDYDKFLYS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctcgcgcgtgaacgaaatcatggccgcggccgaggatatgatccaggaattc
ggcttccgcctgccgcccttcgcgtggtggagcccggccgagttcaaggcgcgccttccg
caggcgcagcgtatcgtggaagccgcgatgggctgggacatcaccgattacgggcagggc
gatttcgacaagctgggcctgttcctcttcaccctgcgcaacggcgatctgcgcgacctt
caggcaggtcacggtatggcgtacgccgaaaagctgctgatctcgcgcaaggaccagatc
agcccgatgcatacccatatcatcaaggccgaggacatcatcaaccgtggcggtgcgaac
ctcgcgatcgagctctacggctctgatgcagatggcaaatttgacgacactgcgggcggg
caggtgatgtgcgacggtgtcccgcgccgctacgagcccggcgaagttctgatcctgcgt
ccgggcgagagcgtgaccctgcgccccggcgactggcatgccttctggggtgagggcggc
gacgttctgatcggcgaggtctcgaccgtcaatgacgacaacaccgacaacattttccgc
gaagatatcgggcggttctccgagatcgaggaagacgaagcgccgcgccacctgctggtc
agcgactacgacaagttcctgtactcataa

DBGET integrated database retrieval system