KEGG   Thioclava nitratireducens: BMG03_09210Help
Entry
BMG03_09210       CDS       T04697                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
thw  Thioclava nitratireducens
Pathway
thw00071  Fatty acid degradation
thw00072  Synthesis and degradation of ketone bodies
thw00280  Valine, leucine and isoleucine degradation
thw00310  Lysine degradation
thw00362  Benzoate degradation
thw00380  Tryptophan metabolism
thw00620  Pyruvate metabolism
thw00630  Glyoxylate and dicarboxylate metabolism
thw00640  Propanoate metabolism
thw00650  Butanoate metabolism
thw00900  Terpenoid backbone biosynthesis
thw01100  Metabolic pathways
thw01110  Biosynthesis of secondary metabolites
thw01120  Microbial metabolism in diverse environments
thw01130  Biosynthesis of antibiotics
thw01200  Carbon metabolism
thw01212  Fatty acid metabolism
thw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMG03_09210
   00630 Glyoxylate and dicarboxylate metabolism
    BMG03_09210
   00640 Propanoate metabolism
    BMG03_09210
   00650 Butanoate metabolism
    BMG03_09210
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMG03_09210
   00072 Synthesis and degradation of ketone bodies
    BMG03_09210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMG03_09210
   00310 Lysine degradation
    BMG03_09210
   00380 Tryptophan metabolism
    BMG03_09210
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMG03_09210
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMG03_09210
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMG03_09210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thw04147]
    BMG03_09210
Enzymes [BR:thw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMG03_09210
Exosome [BR:thw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMG03_09210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AQS47964
UniProt: A0A1S6IEL7
Position
complement(1912944..1914110)
Genome map
AA seq 388 aa AA seqDB search
MDAKIVGWGHTKFGKLEGRTLEDLVLEAGGGALEHAGIDPAEIDGIWLGHFNSGLVPDGF
ASSLALGIDDKLRFTPATRVENACASGSAAIYAARDAIRSGRVKAALVIGAEKMTAKDTA
GVTEALAGASYQMEEAGVSFPQIFARFAQAYYQSHGDRSAALARIAAKNHHNALANPLAQ
MRKDVGFEFCNTVSDKNPMIAPPLRMTDCSLISDGAAALVMVADDRAGDFANSIGFRAAE
QVNDYLPMSRRDLLAFEGPAEAFRRAYASAGVGVGDLSFAEVHDCFTIAELLVYEAMGLV
PQGAGARAIDDGLVLRDGKLPVNLSGGLKAKGHPVGATGVSMHVLAAMQLTGQAGEMQLP
GAELGCVFNMGGSGVANYCSILEAERAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaagatcgtcggctggggccatacgaaattcggcaagctggaggggcgcacg
ctcgaggatctggttctcgaagcgggcggcggcgcgttggagcacgccgggatcgacccg
gcagagatcgacggcatctggctggggcatttcaactccgggctggtgccggacgggttc
gcaagctcgctggcgctggggatcgacgacaagctgcgcttcacgcctgcgacccgcgtc
gagaacgcctgcgcgtcgggctcggctgcgatctatgccgcgcgcgatgcgatccgctcg
ggccgggtgaaggccgcgctggtcatcggggccgagaagatgaccgcgaaggacaccgct
ggcgtgaccgaggcactggccggggcatcttaccagatggaggaggcgggcgtttcgttc
ccgcagattttcgcgcgtttcgcgcaggcctattatcagtcgcatggcgaccgctcggcc
gcgctggcccggatcgcggcgaagaaccaccacaatgcgctcgccaacccgctggcgcag
atgcgcaaggatgtggggttcgagttctgcaacacggtgagcgacaagaacccgatgatc
gccccgccgctgcggatgaccgattgctcgctgatctccgacggggcggcggcgctggtc
atggtcgcggacgaccgcgcgggcgatttcgccaattccataggtttccgcgccgccgag
caggtcaatgactacctgccgatgtcgcgccgcgatctgctggccttcgagggcccggcg
gaggctttccgccgtgcctatgcttcggcgggcgtgggggtcggtgatctctccttcgcc
gaggtccatgactgtttcaccatcgcggaattgctcgtctacgaggcgatggggctggtg
ccgcaaggcgccggcgcgcgcgccatcgacgacgggctcgtgctgcgcgacgggaagctt
ccggtgaacctctcgggcgggctgaaggccaaggggcatcccgtgggcgcgaccggcgtg
tcgatgcatgtgctggccgcgatgcagctcaccggtcaggcgggcgagatgcaactgccc
ggcgcggaactgggttgcgtcttcaatatgggcggctcgggcgtcgcgaattactgctcg
atcctcgaagcggagcgcgcggcatga

DBGET integrated database retrieval system