KEGG   Thioclava nitratireducens: BMG03_10095Help
Entry
BMG03_10095       CDS       T04697                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
thw  Thioclava nitratireducens
Pathway
thw00270  Cysteine and methionine metabolism
thw00920  Sulfur metabolism
thw01100  Metabolic pathways
thw01110  Biosynthesis of secondary metabolites
thw01130  Biosynthesis of antibiotics
thw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BMG03_10095
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMG03_10095
Enzymes [BR:thw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BMG03_10095
    2.3.1.46  homoserine O-succinyltransferase
     BMG03_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AQS48113
Position
complement(2086509..2087429)
Genome map
AA seq 306 aa AA seqDB search
MPIKLPENLPAFDILSREGVMVMSPERASRQEIRPIRIGLLNLMPKKIQTENQFARLIGA
TPLQIDFQLIRMSEHQTKNTAAEHMEEFYRPFEEVEATGEKFDGLIITGAPIEHLPFEEV
TYWEELKRIFDWTQTHVFSTFGVCWGGMAMAHYFHGVNKHMLDHKAFGCFRHRNCAPASP
YLRGFSDDLLIPVSRWTEMRRDELEAAGMITLIHSDETGPCLVEDRAHRALYIFNHLEYD
SGTLKEEYDRDVAAGKPINVPANYYPENDPSRVPTNRWKSHAHLLYGNWINEIYQETPYD
LAEIGN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaagctgcctgaaaacctccccgccttcgacatcctgtcgcgggaaggcgtg
atggtgatgtcgcccgagcgcgcatcgcggcaggaaatccgacccatccggatcggcctt
ctcaatctcatgccgaagaaaatccagaccgagaaccagttcgcacgcctgatcggggcg
acgccgctgcagatcgacttccagctgatccgcatgagcgagcatcagacgaagaacacc
gccgccgagcatatggaagagttctaccgtcccttcgaagaggtcgaggccaccggcgag
aagttcgacgggctgatcatcaccggtgctccgatcgaacatttgcctttcgaggaggtg
acttactgggaagagctcaagcggattttcgactggactcagacccatgtcttttcgacc
ttcggcgtctgctggggcggcatggcgatggcccactacttccacggcgtgaacaagcac
atgcttgatcacaaggccttcggctgcttccggcatcgcaattgcgcgcccgcctcgcct
tacctgcgcggcttctcggacgatctgctgatcccggtgagccgctggaccgagatgcgg
cgtgacgagttggaagcggcgggcatgatcacgctgatccattccgatgaaaccgggccc
tgtctggtcgaagatcgcgctcatcgggcgctctacatcttcaaccatctggaatatgac
agcggcacgctgaaagaagaatacgatcgtgacgtcgcggcggggaaaccgatcaacgtc
cccgcgaattactatcctgagaacgacccgagccgggtgccgacgaaccggtggaagagc
cacgcccacctgctttacggcaactggattaacgagatttatcaggaaactccgtatgat
ctggccgagattggtaactag

DBGET integrated database retrieval system