KEGG   Thioclava nitratireducens: BMG03_10995Help
Entry
BMG03_10995       CDS       T04697                                 

Definition
(GenBank) phospholipase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
thw  Thioclava nitratireducens
Pathway
thw00562  Inositol phosphate metabolism
thw00564  Glycerophospholipid metabolism
thw01100  Metabolic pathways
thw01110  Biosynthesis of secondary metabolites
thw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BMG03_10995
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMG03_10995
   00565 Ether lipid metabolism
    BMG03_10995
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMG03_10995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:thw02042]
    BMG03_10995
Enzymes [BR:thw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BMG03_10995
Bacterial toxins [BR:thw02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BMG03_10995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase Sulfatase DUF2742
Motif
Other DBs
NCBI-ProteinID: AQS48266
Position
2298939..2300567
Genome map
AA seq 542 aa AA seqDB search
MIDTLRPTGAVSALALACAAATAQAGTAADTQTATPIKHLVVIFQENVSFDHYFATYPKA
ANPKGEPQFTAAKDTPKANTLASAGLLKNNPNKSNAVNGANAAAPFRLDRTQAASADQNH
GYTAEQAAFHGGKMDAFPANTGKGTKGGTGAFGTKGQVMGYYDGNTVTALWNYAQAYAMN
DNAFSSTFGPSTPGAINLVSGQTNGAVLPKGYKLEADGTYDKGRVVPDGNGGWTMISDLD
PTGDVCSNPKYPTTLMGGKNIGDLLNAKHVTWGWFEGGFDLTAVNGNGTTGCDRSSLSQV
TGETSKDYIPHHEPFQYYKSTRNVDHTRPASVDVIGTSDDGGANHQYDSKDFYAALKNGN
LPAVSFLKAPAYQDGHAGYSDPLDGQEFIVNAVNALQKSNDWKDTAIVVTYDDSDGWYDH
AMAVVNGSNIPVAGYDVLNGSNCASDKTLPGLDGKPAQGRCGYGTRIPMLVISPYAKKNA
VDHTLVDQSSVTKFIEDNWLNGQRIGQGSFDAQAGELNGMFDFSKAANGKLILDPATGNP
KG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacacgctccgcccgaccggtgccgtcagcgcgctcgcgctggcttgcgccgcc
gcgaccgcccaggctggcaccgccgccgacacccagaccgccaccccgatcaagcatctc
gtggtgattttccaggagaacgtctccttcgaccattatttcgcgacctatccgaaggcc
gccaaccccaagggcgagccgcaattcaccgccgcgaaagacacgcccaaggccaatacg
ctcgcaagcgccggtctgctgaagaacaaccccaacaagagcaatgccgtcaatggcgcg
aatgccgccgccccgttccggctcgaccggacgcaggccgcgtccgccgaccagaaccac
ggctacaccgccgagcaggccgctttccacggcggcaagatggatgccttcccggccaat
accggcaagggcacgaaaggcggcacgggcgcattcggcaccaagggccaggtgatgggc
tattacgacggcaataccgtcaccgcactgtggaactacgcgcaggcctacgcgatgaac
gacaatgccttctcgagcaccttcggcccctcgacgccgggcgcgatcaacctcgtctcg
ggccagaccaatggcgcggtgctgcccaagggctacaagctcgaagccgacggcacctat
gacaaggggcgcgtcgtgcccgacggcaatggcggctggaccatgatctccgatctcgat
ccgaccggcgatgtctgctcgaacccgaaataccccacgacgcttatgggcggcaagaat
atcggcgatctgctgaacgccaaacacgttacctggggctggttcgagggcggcttcgat
ctgaccgcggtgaacggcaacggcaccaccggctgcgaccgctcgtcgctctcgcaggtg
accggcgagacctcgaaggactacatcccccaccacgagcccttccagtattacaaatcg
acccggaacgtcgatcacacccgtcccgcctcggtcgatgtgatcggcacgtcggacgat
ggcggcgcgaaccaccaatatgacagcaaggatttctacgcggccctgaagaacggcaac
ctgccggcggtgagcttcctgaaagcgcccgcctatcaggacggccatgcgggctattcc
gacccgctcgatgggcaggagttcatcgtcaacgcggtcaacgcgctgcagaaatcgaac
gactggaaggacactgcgatcgtcgtgacctacgacgattccgatggctggtatgaccac
gcgatggcagtggtgaatggctcgaacatcccggtcgcgggctatgacgtgctcaatggc
agcaactgcgccagcgacaagacgctgcccgggctcgacggaaagcccgcgcagggccgt
tgcggctatggcacccgcatcccgatgctggtgatctcgccctatgccaagaagaacgcg
gtggatcacacactggtcgatcagtcatcggtcaccaagtttatcgaggataactggctg
aacggtcagcgcatcggtcagggctccttcgacgcccaggcgggcgagctgaacggcatg
ttcgacttctcgaaagcggccaatggcaagctgatcctcgacccggccaccggcaacccg
aaaggctga

DBGET integrated database retrieval system