KEGG   Thioclava nitratireducens: BMG03_15535Help
Entry
BMG03_15535       CDS       T04697                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
thw  Thioclava nitratireducens
Pathway
thw00350  Tyrosine metabolism
thw00360  Phenylalanine metabolism
thw00380  Tryptophan metabolism
thw01100  Metabolic pathways
thw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BMG03_15535
   00360 Phenylalanine metabolism
    BMG03_15535
   00380 Tryptophan metabolism
    BMG03_15535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thw04147]
    BMG03_15535
Enzymes [BR:thw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     BMG03_15535
    4.1.1.105  L-tryptophan decarboxylase
     BMG03_15535
Exosome [BR:thw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMG03_15535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AQS49041
Position
complement(3226215..3227627)
Genome map
AA seq 470 aa AA seqDB search
MDAQDFETWSRRAAEWGVKYRETLDARPVRARTTPGEIYRAIPPRPPENGCEMERIFDEF
ESLIEPGMTHWQHPRFFAYFPSNAAPVSVMAEYLVTAMAAQCMLWQTSPAATELETRMME
WLRDALGLPEAFSGVIQDSASSATLAAVLMMRERTLGWQGNRAGLSQALRLRIYCSDQVH
SSIDRAIWIAGIGQDNLVKLPADLRSGALPPEALEAAIRADLAAGYQPAGVIGCVGATST
GACDDIGELVAVAHAHDLLIHVDAAWAGSAMICPEFRTLWAGIEGADSVVFNPHKWLGAS
FDCSAHFIRDPEMLVRTLAIQPEYLKTHGRDGVVNYSEWSVPLGRRFRALKLWFLLRFHG
LEGLRAMIRDHVRWAGMLHDRLAATPGVEIVTAPVLSLFSFRRAGASDDDTISHLSAIND
DGRIYLTQTRVGSQLAIRFQAGSFAMREADIDIAYSAILDGLGLSQEGMS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggatgctcaggatttcgagacatggtcgcggcgcgcggcggaatggggcgttaaatat
cgcgaaacactcgatgcccgcccggtgcgcgcgcgcacgacgcccggcgagatctaccgc
gcgatcccgcccaggccgcccgagaacggctgcgaaatggagcggatctttgacgagttc
gagagcctgatcgagccgggcatgacccattggcagcatccgcgcttcttcgcttacttt
cccagcaatgccgcccctgtctcggtgatggcggaatatctggtcaccgctatggccgcg
caatgcatgctgtggcagacctctccggccgcgaccgagctggaaacccggatgatggaa
tggctgcgcgacgcgctggggctgcccgaggcgttctcgggcgtcattcaggacagcgcc
tcgtccgcgacgctggcggcggtcttgatgatgcgcgagcgtacgttgggctggcaggga
aatcgcgcggggctcagtcaagcgctacgcctgcggatctattgctcggatcaggtgcat
tcctccatcgatcgggcgatctggatcgcggggatcgggcaggacaaccttgtgaaactg
cccgccgatctgcgtagtggcgcgctcccgcccgaagcgctggaggcggcgatccgcgct
gatctggcggccgggtatcagcccgccggggtaatcggctgcgtcggggcgaccagcacc
ggggcctgcgacgatattggcgagctggttgcggtcgcgcatgcccatgatctgttgatc
catgtcgatgcggcctgggcgggttccgcaatgatctgtcccgagttccgcacgctttgg
gccgggatcgagggtgcggattccgtcgtcttcaatccgcataaatggttgggcgcgtct
ttcgactgctcggcccatttcattcgcgaccccgagatgctggtgcgcacgctggcgatc
cagcccgagtatctcaagacccatggtcgcgatggggtcgtcaactattccgaatggtcc
gtccccctggggcgccgtttccgcgcgctcaagctgtggttcctgctgcgctttcacggg
cttgaggggctgcgcgcgatgatccgcgatcacgttcgctgggcggggatgctgcatgac
cggctggctgcaaccccgggcgttgagatcgtgaccgccccggtgctgtcgctgttctcg
tttcgccgcgcgggcgcatcggacgacgatacgatctcgcatctgagcgcgatcaacgat
gacgggcgcatctaccttacccaaacgcgggtcggcagccagcttgcgatccgcttccag
gccgggtccttcgcgatgcgcgaagccgatatcgacatcgcctacagcgccattctcgat
ggcctgggactttcacaggagggaatgtcatga

DBGET integrated database retrieval system